PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | AT5G50490.1 | ||||||||
Common Name | MBA10.4, NFYC5, NF-YC5 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
|
||||||||
Family | NF-YC | ||||||||
Protein Properties | Length: 186aa MW: 20399.8 Da PI: 4.3662 | ||||||||
Description | nuclear factor Y, subunit C5 | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YC | 167.5 | 1.7e-52 | 17 | 116 | 1 | 100 |
NF-YC 1 qlksfwekqiekatdfknhelPlarikkilkadedvkmisaeaPvllskacelfileltlrswlhaeenkrrtlkksdiaaavtrtdifdflvdivpr 98 qlksfw+k +e + ++knhe+P++rik+i+k+d+dv+mi+aeaP+llskace+f+++lt+rswlha+e++r t++ksd++a+v++t+ifdfl d+vp+ AT5G50490.1 17 QLKSFWSKGMEGDLNVKNHEFPISRIKRIMKFDPDVSMIAAEAPNLLSKACEMFVMDLTMRSWLHAQESNRLTIRKSDVDAVVSQTVIFDFLRDDVPK 114 89************************************************************************************************ PP NF-YC 99 de 100 de AT5G50490.1 115 DE 116 98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF47113 | 6.2E-28 | 2 | 108 | IPR009072 | Histone-fold |
Gene3D | G3DSA:1.10.20.10 | 9.8E-28 | 31 | 99 | IPR009072 | Histone-fold |
Pfam | PF00808 | 3.7E-17 | 36 | 99 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 186 aa Download sequence Send to blast |
MENNNNNHQQ PPKDNEQLKS FWSKGMEGDL NVKNHEFPIS RIKRIMKFDP DVSMIAAEAP 60 NLLSKACEMF VMDLTMRSWL HAQESNRLTI RKSDVDAVVS QTVIFDFLRD DVPKDEGEPV 120 VAAADPVDDV ADHVAVPDLN NEELPPGTVI GTPVCYGLGI HAPHPQMPGA WTEEDATGAN 180 GGNGGN |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5g49_B | 6e-30 | 24 | 114 | 5 | 95 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT C-3 |
Search in ModeBase |
Expression -- Microarray ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | |||||
Expression Atlas | AT5G50490 | |||||
AtGenExpress | AT5G50490 |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in inflorescences and flowers. {ECO:0000269|PubMed:11250072}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. {ECO:0000250}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | AT5G50490.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Interaction ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Intact With | |||||
BioGRID | AT1G09030, AT1G21970 | |||||
IntAct | Search Q9FGP6 |
Phenotype -- Mutation ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | |||||
T-DNA Express | AT5G50490 |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AB025619 | 0.0 | AB025619.1 Arabidopsis thaliana genomic DNA, chromosome 5, P1 clone:MBA10. | |||
GenBank | CP002688 | 0.0 | CP002688.1 Arabidopsis thaliana chromosome 5 sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_199860.1 | 1e-137 | nuclear factor Y, subunit C5 | ||||
Swissprot | Q9FGP6 | 1e-138 | NFYC5_ARATH; Nuclear transcription factor Y subunit C-5 | ||||
TrEMBL | C0SVT3 | 1e-135 | C0SVT3_ARATH; Uncharacterized protein At5g50490 (Fragment) | ||||
STRING | AT5G50490.1 | 1e-136 | (Arabidopsis thaliana) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM17675 | 5 | 10 | Representative plant | OGRP315 | 17 | 117 |
Link Out ? help Back to Top | |
---|---|
Phytozome | AT5G50490.1 |
Entrez Gene | 835117 |
iHOP | AT5G50490 |
wikigenes | AT5G50490 |