PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | AT5G46590.1 | ||||||||
Common Name | anac096, NAC096 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 292aa MW: 33580.5 Da PI: 4.9484 | ||||||||
Description | NAC domain containing protein 96 | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 170.5 | 5.5e-53 | 6 | 134 | 1 | 128 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskk 96 lppGfrFhPtdeel+ +yLk+kveg ++el evi+ +d+y+++Pw+Lp k + +++ ewyfF++rdkky++g r+nr tk+gyWkatgkd++++s++ AT5G46590.1 6 LPPGFRFHPTDEELIEYYLKRKVEGLEIEL-EVIPVIDLYSFDPWELPdKsFLPNRDMEWYFFCSRDKKYPNGFRTNRGTKAGYWKATGKDRKITSRS 102 79****************************.99**************96435556888**************************************** PP NAM 97 gelvglkktLvfykgrapkgektdWvmheyrl 128 ++ +g +ktLvfykgrap g +++W+mheyrl AT5G46590.1 103 SSIIGYRKTLVFYKGRAPLGDRSNWIMHEYRL 134 ******************************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 1.44E-60 | 3 | 158 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 59.099 | 6 | 158 | IPR003441 | NAC domain |
Pfam | PF02365 | 3.3E-29 | 7 | 134 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0007275 | Biological Process | multicellular organism development | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding |
Plant Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PO Term | PO Category | PO Description | ||||
PO:0000037 | anatomy | shoot apex | ||||
PO:0000084 | anatomy | plant sperm cell | ||||
PO:0000293 | anatomy | guard cell | ||||
PO:0009009 | anatomy | plant embryo | ||||
PO:0009010 | anatomy | seed | ||||
PO:0009031 | anatomy | sepal | ||||
PO:0009046 | anatomy | flower | ||||
PO:0009052 | anatomy | flower pedicel | ||||
PO:0020100 | anatomy | hypocotyl | ||||
PO:0025022 | anatomy | collective leaf structure | ||||
PO:0001078 | developmental stage | plant embryo cotyledonary stage | ||||
PO:0001081 | developmental stage | mature plant embryo stage | ||||
PO:0001185 | developmental stage | plant embryo globular stage | ||||
PO:0004507 | developmental stage | plant embryo bilateral stage | ||||
PO:0007611 | developmental stage | petal differentiation and expansion stage | ||||
PO:0007616 | developmental stage | flowering stage |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 292 aa Download sequence Send to blast |
MGSSCLPPGF RFHPTDEELI EYYLKRKVEG LEIELEVIPV IDLYSFDPWE LPDKSFLPNR 60 DMEWYFFCSR DKKYPNGFRT NRGTKAGYWK ATGKDRKITS RSSSIIGYRK TLVFYKGRAP 120 LGDRSNWIMH EYRLCDDDTS QGSQNLKGAF VLCRVAMKNE IKTNTKIRKI PSEQTIGSGE 180 SSGLSSRVTS PSRDETMPFH SFANPVSTET DSSNIWISPE FILDSSKDYP QIQDVASQCF 240 QQDFDFPIIG NQNMEFPAST SLDQNMDEFM QNGYWTNYGY DQTGLFGYSD FS |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ut4_A | 5e-51 | 6 | 159 | 17 | 166 | NO APICAL MERISTEM PROTEIN |
1ut4_B | 5e-51 | 6 | 159 | 17 | 166 | NO APICAL MERISTEM PROTEIN |
1ut7_A | 5e-51 | 6 | 159 | 17 | 166 | NO APICAL MERISTEM PROTEIN |
1ut7_B | 5e-51 | 6 | 159 | 17 | 166 | NO APICAL MERISTEM PROTEIN |
4dul_A | 5e-51 | 6 | 159 | 17 | 166 | NAC domain-containing protein 19 |
4dul_B | 5e-51 | 6 | 159 | 17 | 166 | NAC domain-containing protein 19 |
Search in ModeBase |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
At.51256 | 0.0 | flower| seed |
Expression -- Microarray ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | E-value | ||||
GEO | 145358926 | 0.0 | ||||
Genevisible | 248855_at | 0.0 | ||||
Expression Atlas | AT5G46590 | - | ||||
AtGenExpress | AT5G46590 | - | ||||
ATTED-II | AT5G46590 | - |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in roots, rosettes leaves, cauline leaves and stems. {ECO:0000269|PubMed:24285786}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional activator involved in the positive regulation of abscisic acid (ABA) responsive genes. Acts as a positive factor of ABA-mediated responses. Involved in the transcriptional activation of ABA-inducible genes in response to dehydration and osmotic stresses. Plays a positive role in both stomatal closure and water loss under dehydration stress conditions. Acts synergistically with ABF2 to activate the dehydration stress-response factor RD29A transcription. Binds to the consensus core cis-acting elements 5'-CGTA-3' and 5'-CACG-3' at the RD29A promoter (PubMed:24285786). Involved in hypocotyl graft union formation. Required for the auxin-mediated promotion of vascular tissue proliferation during hypocotyl graft attachment (PubMed:25182467). {ECO:0000269|PubMed:24285786, ECO:0000269|PubMed:25182467}. |
Function -- GeneRIF ? help Back to Top | ||||||
---|---|---|---|---|---|---|
|
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00546 | DAP | 27203113 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | AT5G46590.1 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by abscisic acid (ABA), dehydration and osmotic stress. {ECO:0000269|PubMed:24285786}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Phenotype -- Mutation ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | |||||
T-DNA Express | AT5G46590 |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | BT020305 | 0.0 | BT020305.1 Arabidopsis thaliana At5g46590 gene, complete cds. | |||
GenBank | BT020555 | 0.0 | BT020555.1 Arabidopsis thaliana At5g46590 gene, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_199471.1 | 0.0 | NAC domain containing protein 96 | ||||
Swissprot | Q9LS24 | 0.0 | NAC96_ARATH; NAC domain-containing protein 96 | ||||
TrEMBL | A0A178UGR4 | 0.0 | A0A178UGR4_ARATH; NAC096 | ||||
STRING | AT5G46590.1 | 0.0 | (Arabidopsis thaliana) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM2151 | 27 | 77 | Representative plant | OGRP17 | 15 | 800 |
Link Out ? help Back to Top | |
---|---|
Phytozome | AT5G46590.1 |
Entrez Gene | 834702 |
iHOP | AT5G46590 |
wikigenes | AT5G46590 |