PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

AT5G46350.1

Common Name

ATWRKY8, MPL12.15, WRKY8

Organism

Arabidopsis thaliana

Taxonomic ID

3702

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis

Family

WRKY

Protein Properties

Length: 326aa MW: 37294 Da PI: 8.0888

Description

WRKY DNA-binding protein 8

Gene Model

Gene Model ID	Type	Source	Coding Sequence
AT5G46350.1	genome	TAIR	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	WRKY	104.2	7.1e-33	183	240	2	59
--SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 +Dgy+WrKYGqK vk+s++prsYYrCt+++C+vkk+vers +dp+vv++tYe++Hnh+ AT5G46350.1 183 EDGYRWRKYGQKAVKNSPYPRSYYRCTTQKCNVKKRVERSYQDPTVVITTYESQHNHP 240 8********************************************************7 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PIRSF	PIRSF038130	1.2E-112	1	326	IPR017396	PWRKY transcription factor, group IIc
Gene3D	G3DSA:2.20.25.80	3.2E-34	167	242	IPR003657	WRKY domain
SuperFamily	SSF118290	5.62E-29	174	242	IPR003657	WRKY domain
PROSITE profile	PS50811	32.282	177	242	IPR003657	WRKY domain
SMART	SM00774	6.1E-38	182	241	IPR003657	WRKY domain
Pfam	PF03106	2.1E-25	183	240	IPR003657	WRKY domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0009737	Biological Process	response to abscisic acid
GO:0042742	Biological Process	defense response to bacterium
GO:0050832	Biological Process	defense response to fungus
GO:0051607	Biological Process	defense response to virus
GO:0070301	Biological Process	cellular response to hydrogen peroxide
GO:1901002	Biological Process	positive regulation of response to salt stress
GO:0005634	Cellular Component	nucleus
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0005515	Molecular Function	protein binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Plant Ontology ? help Back to Top
PO Term	PO Category	PO Description
PO:0000013	anatomy	cauline leaf
PO:0000037	anatomy	shoot apex
PO:0000230	anatomy	inflorescence meristem
PO:0000293	anatomy	guard cell
PO:0009005	anatomy	root
PO:0009006	anatomy	shoot system
PO:0009025	anatomy	vascular leaf
PO:0009029	anatomy	stamen
PO:0009030	anatomy	carpel
PO:0009031	anatomy	sepal
PO:0009046	anatomy	flower
PO:0009047	anatomy	stem
PO:0020030	anatomy	cotyledon
PO:0020038	anatomy	petiole
PO:0020137	anatomy	leaf apex
PO:0025022	anatomy	collective leaf structure
PO:0025195	anatomy	pollen tube cell
PO:0001054	developmental stage	vascular leaf senescent stage
PO:0007064	developmental stage	LP.12 twelve leaves visible stage
PO:0007095	developmental stage	LP.08 eight leaves visible stage
PO:0007098	developmental stage	LP.02 two leaves visible stage
PO:0007103	developmental stage	LP.10 ten leaves visible stage
PO:0007115	developmental stage	LP.04 four leaves visible stage
PO:0007123	developmental stage	LP.06 six leaves visible stage
PO:0007611	developmental stage	petal differentiation and expansion stage
PO:0007616	developmental stage	flowering stage

Sequence ? help Back to Top
Protein Sequence Length: 326 aa Download sequence Send to blast
MSHEIKDLNN YHYTSSYNHY NINNQNMINL PYVSGPSAYN ANMISSSQVG FDLPSKNLSP 60 QGAFELGFEL SPSSSDFFNP SLDQENGLYN AYNYNSSQKS HEVVGDGCAT IKSEVRVSAS 120 PSSSEADHHP GEDSGKIRKK REVRDGGEDD QRSQKVVKTK KKEEKKKEPR VSFMTKTEVD 180 HLEDGYRWRK YGQKAVKNSP YPRSYYRCTT QKCNVKKRVE RSYQDPTVVI TTYESQHNHP 240 IPTNRRTAMF SGTTASDYNP SSSPIFSDLI INTPRSFSND DLFRVPYASV NVNPSYHQQQ 300 HGFHQQESEF ELLKEMFPSV FFKQEP

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1wj2_A	4e-28	172	242	7	77	Probable WRKY transcription factor 4
2lex_A	4e-28	172	242	7	77	Probable WRKY transcription factor 4
Search in ModeBase

Expression -- Microarray ? help Back to Top
Source	ID	E-value
Genevisible	248896_at	0.0
Expression Atlas	AT5G46350	-
AtGenExpress	AT5G46350	-
ATTED-II	AT5G46350	-

Expression -- Description ? help Back to Top
Source	Description
Uniprot	TISSUE SPECIFICITY: Highly expressed in roots and at lower levels in rosette leaves, cauline leaves, stems, flowers and siliques. {ECO:0000269\|PubMed:23451802}.

Functional Description ? help Back to Top
Source	Description
TAIR	member of WRKY Transcription Factor; Group II-c
UniProt	Transcription factor. Interacts specifically with the W box (5'-TTGAC[CT]-3'), a frequently occurring stress-responsive cis-acting element. Functions as positive regulator of salt stress response. Binds the W box of LTI78/RD29A stress-response gene and directly regulates its transcription under salt stress. Functions antagonistically with VQ9 to regulate sodium and potassium homeostasis under salt stress by regulating the expression of downstream SOS (SALT OVERLY SENSITIVE) stress-responsive genes. The DNA-binding activity of WRKY8 is decreased by VQ9 (PubMed:23451802). Functions as negative regulator of basal resistance to the bacterial pathogen P. syringae and as positive regulator of resistance to the fungal pathogen to B. cinerea (PubMed:20367464). Functions as positive regulator of defense response againt tobamovirus (TMV) by regulating both the abscisic acid and ethylene signaling pathways. Positively regulates ABI4 expression and negatively modulates ACS6 and ERF104 expression by directly binding to the W box consensus motifs within their promoters (PubMed:23650359). {ECO:0000269\|PubMed:20367464, ECO:0000269\|PubMed:23451802, ECO:0000269\|PubMed:23650359}.

Function -- GeneRIF ? help Back to Top
WRKY8 is a negative regulator of basal resistance to P. syringae and positive regulator to B. cinerea. [PMID: 20367464] Data indicate that WRKY8 interacts with VQ9 (At1g78310) in the nucleus of plant cells, and binds the promoter of RD29A (AT5G52310), in vivo. [PMID: 23451802] WRKY8 is involved in the defense response against TMV-cg through the direct regulation of the expression of ABI4, ACS6, and ERF104 and may mediate the crosstalk between ABA and ethylene signaling during the TMV-cg-Arabidopsis interaction. [PMID: 23650359]

Binding Motif ? help Back to Top
Motif ID	Method	Source	Motif file
MP00545	DAP	27203113	Download

Cis-element ? help Back to Top
Source	Link
PlantRegMap	AT5G46350.1

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By wounding, abscisic acid (ABA), salicylic acid (SA), H(2)O(2), and infection with P.syringae pv. tomato DC3000 and B.cinerea (PubMed:20367464). Induced by salt stress (PubMed:23451802). {ECO:0000269\|PubMed:20367464, ECO:0000269\|PubMed:23451802}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	Retrieve

Regulation -- Hormone ? help Back to Top
Source	Hormone
AHD	salicylic acid

Phenotype -- Disruption Phenotype ? help Back to Top
Source	Description
UniProt	DISRUPTION PHENOTYPE: No visible phenotype under normal growth conditions (PubMed:20367464, PubMed:23451802). Mutant plants show increased resistance to the bacterial pathogen P. syringae and enhanced susceptibility to the fungal pathogen to B. cinerea (PubMed:20367464). Mutant plants display increased sensitiviy to salt stress (PubMed:23451802). {ECO:0000269\|PubMed:20367464, ECO:0000269\|PubMed:23451802}.

Phenotype -- Mutation ? help Back to Top
Source	ID
T-DNA Express	AT5G46350

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AF404855	0.0	AF404855.1 Arabidopsis thaliana WRKY transcription factor 8 (WRKY8) mRNA, complete cds.
GenBank	AY063916	0.0	AY063916.1 Arabidopsis thaliana unknown protein (At5g46350) mRNA, complete cds.
GenBank	AY096426	0.0	AY096426.1 Arabidopsis thaliana unknown protein (At5g46350) mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	NP_199447.1	0.0	WRKY DNA-binding protein 8
Swissprot	Q9FL26	0.0	WRKY8_ARATH; WRKY transcription factor 8
TrEMBL	A0A178U9B9	0.0	A0A178U9B9_ARATH; WRKY transcription factor
STRING	AT5G46350.1	0.0	(Arabidopsis thaliana)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM1524	26	93
Representative plant	OGRP14	17	875

Link Out ? help Back to Top
Phytozome	AT5G46350.1
Entrez Gene	834678
iHOP	AT5G46350
wikigenes	AT5G46350

Publications ? help Back to Top
Eulgem T,Rushton PJ,Robatzek S,Somssich IE The WRKY superfamily of plant transcription factors. Trends Plant Sci., 2000. 5(5): p. 199-206 [PMID:10785665] Riechmann JL, et al. Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes. Science, 2000. 290(5499): p. 2105-10 [PMID:11118137] Yamada K, et al. Empirical analysis of transcriptional activity in the Arabidopsis genome. Science, 2003. 302(5646): p. 842-6 [PMID:14593172] Guan Y,Nothnagel EA Binding of arabinogalactan proteins by Yariv phenylglycoside triggers wound-like responses in Arabidopsis cell cultures. Plant Physiol., 2004. 135(3): p. 1346-66 [PMID:15235117] Hass C, et al. The response regulator 2 mediates ethylene signalling and hormone signal integration in Arabidopsis. EMBO J., 2004. 23(16): p. 3290-302 [PMID:15282545] Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Qutob D, et al. Phytotoxicity and innate immune responses induced by Nep1-like proteins. Plant Cell, 2006. 18(12): p. 3721-44 [PMID:17194768] Ascencio-Ib Global analysis of Arabidopsis gene expression uncovers a complex array of changes impacting pathogen response and cell cycle during geminivirus infection. Plant Physiol., 2008. 148(1): p. 436-54 [PMID:18650403] Wang Y, et al. Transcriptome analyses show changes in gene expression to accompany pollen germination and tube growth in Arabidopsis. Plant Physiol., 2008. 148(3): p. 1201-11 [PMID:18775970] Jakoby MJ, et al. Transcriptional profiling of mature Arabidopsis trichomes reveals that NOECK encodes the MIXTA-like transcriptional regulator MYB106. Plant Physiol., 2008. 148(3): p. 1583-602 [PMID:18805951] Chen L,Zhang L,Yu D Wounding-induced WRKY8 is involved in basal defense in Arabidopsis. Mol. Plant Microbe Interact., 2010. 23(5): p. 558-65 [PMID:20367464] Gao X, et al. Bifurcation of Arabidopsis NLR immune signaling via Ca²⁺-dependent protein kinases. PLoS Pathog., 2013. 9(1): p. e1003127 [PMID:23382673] Gao X,He P Nuclear dynamics of Arabidopsis calcium-dependent protein kinases in effector-triggered immunity. Plant Signal Behav, 2013. 8(4): p. e23868 [PMID:23425856] Hu Y, et al. Arabidopsis transcription factor WRKY8 functions antagonistically with its interacting partner VQ9 to modulate salinity stress tolerance. Plant J., 2013. 74(5): p. 730-45 [PMID:23451802] Chen L,Zhang L,Li D,Wang F,Yu D WRKY8 transcription factor functions in the TMV-cg defense response by mediating both abscisic acid and ethylene signaling in Arabidopsis. Proc. Natl. Acad. Sci. U.S.A., 2013. 110(21): p. E1963-71 [PMID:23650359] Sudre D, et al. Iron-dependent modifications of the flower transcriptome, proteome, metabolome, and hormonal content in an Arabidopsis ferritin mutant. J. Exp. Bot., 2013. 64(10): p. 2665-88 [PMID:23682113] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Sukweenadhi J, et al. Paenibacillus yonginensis DCY84(T) induces changes in Arabidopsis thaliana gene expression against aluminum, drought, and salt stress. Microbiol. Res., 2015. 172: p. 7-15 [PMID:25721473]