Signature Domain? help Back to Top |
|
No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
1 | Homeobox | 56 | 6.8e-18 | 53 | 113 | 2 | 57 |
T--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
Homeobox 2 rkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
++R+++++eq+++Le+ F++ + +p +ee++++ +l ++ +++V++WFqNr+ + k+
AT5G45980.1 53 KPRWNPKPEQIRILESIFNSgTINPPREEIQRIRIRLqeygQIGDANVFYWFQNRKSRAKH 113
89*****************99*************************************995 PP
|
2 | Wus_type_Homeobox | 109.4 | 2.1e-35 | 52 | 114 | 2 | 64 |
Wus_type_Homeobox 2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqk 64
+++RW+P+peQi+iLe++++sG+ +P++eeiqri+ +L+eyG+i+d+NVfyWFQNrk+R ++k
AT5G45980.1 52 PKPRWNPKPEQIRILESIFNSGTINPPREEIQRIRIRLQEYGQIGDANVFYWFQNRKSRAKHK 114
579**********************************************************99 PP
|
Expression --
Description ? help
Back to Top |
Source |
Description |
Uniprot | DEVELOPMENTAL STAGE: Detected in the egg cell and the central cell of the embryo sac (PubMed:14711878). After fertilization, it is expressed in the zygote (PubMed:14711878). After the first division of the zygote, it is detected exclusively in the basal daughter cell, while WOX2 is expressed in the apical daughter cell (PubMed:14711878). Through the 16-cell stage, it is expressed in all descendants of the basal daughter, the developing suspensor and the hypophyseal cell (PubMed:14711878). After the hypophysis had divided, expression stops in descendants, but remains present in the extra embryonic suspensor (PubMed:14711878). Moreover it is found in the cellularized endosperm of the micropylar region during the globular and heart stages of embryogenesis (PubMed:14711878). Not expressed later in embryogenesis or in postembryonic stages (PubMed:14711878). Activated in the zygote after fertilization (PubMed:21316593). {ECO:0000269|PubMed:14711878, ECO:0000269|PubMed:21316593}. |
Uniprot | TISSUE SPECIFICITY: Expressed only in the egg cell (PubMed:21316593). Not detected in the pollen tube (PubMed:21316593). Expressed in the zygote, the basal cell, and later the suspensor (PubMed:21802295). Expressed in all suspensor cells, except the hypophysis, and in the embryo surrounding region (ESR) endosperm cells (PubMed:22427333). Strongly expressed in the suspensor cells, with a weak expression also detected throughout the developing embryo (PubMed:22827849). {ECO:0000269|PubMed:21316593, ECO:0000269|PubMed:21802295, ECO:0000269|PubMed:22427333, ECO:0000269|PubMed:22827849}. |
Publications
? help Back to Top |
- Riechmann JL, et al.
Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes. Science, 2000. 290(5499): p. 2105-10 [PMID:11118137] - R
Rapid identification of Arabidopsis insertion mutants by non-radioactive detection of T-DNA tagged genes. Plant J., 2002. 32(2): p. 243-53 [PMID:12383089] - Dal Bosco C, et al.
Inactivation of the chloroplast ATP synthase gamma subunit results in high non-photochemical fluorescence quenching and altered nuclear gene expression in Arabidopsis thaliana. J. Biol. Chem., 2004. 279(2): p. 1060-9 [PMID:14576160] - Haecker A, et al.
Expression dynamics of WOX genes mark cell fate decisions during early embryonic patterning in Arabidopsis thaliana. Development, 2004. 131(3): p. 657-68 [PMID:14711878] - Hilson P, et al.
Versatile gene-specific sequence tags for Arabidopsis functional genomics: transcript profiling and reverse genetics applications. Genome Res., 2004. 14(10B): p. 2176-89 [PMID:15489341] - Xiao W, et al.
DNA methylation is critical for Arabidopsis embryogenesis and seed viability. Plant Cell, 2006. 18(4): p. 805-14 [PMID:16531498] - Wu X,Chory J,Weigel D
Combinations of WOX activities regulate tissue proliferation during Arabidopsis embryonic development. Dev. Biol., 2007. 309(2): p. 306-16 [PMID:17706632] - Breuninger H,Rikirsch E,Hermann M,Ueda M,Laux T
Differential expression of WOX genes mediates apical-basal axis formation in the Arabidopsis embryo. Dev. Cell, 2008. 14(6): p. 867-76 [PMID:18539115] - Rebocho AB, et al.
Role of EVERGREEN in the development of the cymose petunia inflorescence. Dev. Cell, 2008. 15(3): p. 437-47 [PMID:18804438] - Nardmann J,Reisewitz P,Werr W
Discrete shoot and root stem cell-promoting WUS/WOX5 functions are an evolutionary innovation of angiosperms. Mol. Biol. Evol., 2009. 26(8): p. 1745-55 [PMID:19387013] - Palovaara J,Hakman I
WOX2 and polar auxin transport during spruce embryo pattern formation. Plant Signal Behav, 2009. 4(2): p. 153-5 [PMID:19649198] - Wuest SE, et al.
Arabidopsis female gametophyte gene expression map reveals similarities between plant and animal gametes. Curr. Biol., 2010. 20(6): p. 506-12 [PMID:20226671] - Hirakawa Y,Kondo Y,Fukuda H
TDIF peptide signaling regulates vascular stem cell proliferation via the WOX4 homeobox gene in Arabidopsis. Plant Cell, 2010. 22(8): p. 2618-29 [PMID:20729381] - Zhang X,Zong J,Liu J,Yin J,Zhang D
Genome-wide analysis of WOX gene family in rice, sorghum, maize, Arabidopsis and poplar. J Integr Plant Biol, 2010. 52(11): p. 1016-26 [PMID:20977659] - Ueda M,Zhang Z,Laux T
Transcriptional activation of Arabidopsis axis patterning genes WOX8/9 links zygote polarity to embryo development. Dev. Cell, 2011. 20(2): p. 264-70 [PMID:21316593] - Jeong S,Palmer TM,Lukowitz W
The RWP-RK factor GROUNDED promotes embryonic polarity by facilitating YODA MAP kinase signaling. Curr. Biol., 2011. 21(15): p. 1268-76 [PMID:21802295] - Fiume E,Fletcher JC
Regulation of Arabidopsis embryo and endosperm development by the polypeptide signaling molecule CLE8. Plant Cell, 2012. 24(3): p. 1000-12 [PMID:22427333] - Lie C,Kelsom C,Wu X
WOX2 and STIMPY-LIKE/WOX8 promote cotyledon boundary formation in Arabidopsis. Plant J., 2012. 72(4): p. 674-82 [PMID:22827849] - Wang W, et al.
Dwarf Tiller1, a Wuschel-related homeobox transcription factor, is required for tiller growth in rice. PLoS Genet., 2014. 10(3): p. e1004154 [PMID:24625559] - Zhu T,Moschou PN,Alvarez JM,Sohlberg JJ,von Arnold S
Wuschel-related homeobox 8/9 is important for proper embryo patterning in the gymnosperm Norway spruce. J. Exp. Bot., 2014. 65(22): p. 6543-52 [PMID:25205582] - Jin J, et al.
An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors. Mol. Biol. Evol., 2015. 32(7): p. 1767-73 [PMID:25750178] - Ueda M, et al.
Transcriptional integration of paternal and maternal factors in the Arabidopsis zygote. Genes Dev., 2017. 31(6): p. 617-627 [PMID:28404632]
|