Signature Domain? help Back to Top |
|
No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
1 | SBP | 129.1 | 1.7e-40 | 169 | 244 | 2 | 77 |
-SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
SBP 2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77
CqvegC+ dls+ak+yhr+h++Ce hsk p+v+vsg+e+rfCqqCsrfh lsefDe+krsCrrrL++hn+rrrk++
AT5G43270.1 169 CQVEGCNLDLSSAKDYHRKHRICENHSKFPKVVVSGVERRFCQQCSRFHCLSEFDEKKRSCRRRLSDHNARRRKPN 244
**************************************************************************86 PP
|
Publications
? help Back to Top |
- Cardon G, et al.
Molecular characterisation of the Arabidopsis SBP-box genes. Gene, 1999. 237(1): p. 91-104 [PMID:10524240] - Riechmann JL, et al.
Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes. Science, 2000. 290(5499): p. 2105-10 [PMID:11118137] - Rhoades MW, et al.
Prediction of plant microRNA targets. Cell, 2002. 110(4): p. 513-20 [PMID:12202040] - Kasschau KD, et al.
P1/HC-Pro, a viral suppressor of RNA silencing, interferes with Arabidopsis development and miRNA unction. Dev. Cell, 2003. 4(2): p. 205-17 [PMID:12586064] - Schmid M, et al.
Dissection of floral induction pathways using global expression analysis. Development, 2003. 130(24): p. 6001-12 [PMID:14573523] - Vazquez F,Gasciolli V,Cr
The nuclear dsRNA binding protein HYL1 is required for microRNA accumulation and plant development, but not posttranscriptional transgene silencing. Curr. Biol., 2004. 14(4): p. 346-51 [PMID:14972688] - Yamasaki K, et al.
A novel zinc-binding motif revealed by solution structures of DNA-binding domains of Arabidopsis SBP-family transcription factors. J. Mol. Biol., 2004. 337(1): p. 49-63 [PMID:15001351] - Chen J,Li WX,Xie D,Peng JR,Ding SW
Viral virulence protein suppresses RNA silencing-mediated defense but upregulates the role of microrna in host gene expression. Plant Cell, 2004. 16(5): p. 1302-13 [PMID:15100397] - Yoo BC, et al.
A systemic small RNA signaling system in plants. Plant Cell, 2004. 16(8): p. 1979-2000 [PMID:15258266] - Cao D,Cheng H,Wu W,Soo HM,Peng J
Gibberellin mobilizes distinct DELLA-dependent transcriptomes to regulate seed germination and floral development in Arabidopsis. Plant Physiol., 2006. 142(2): p. 509-25 [PMID:16920880] - Schwarz S,Grande AV,Bujdoso N,Saedler H,Huijser P
The microRNA regulated SBP-box genes SPL9 and SPL15 control shoot maturation in Arabidopsis. Plant Mol. Biol., 2008. 67(1-2): p. 183-95 [PMID:18278578] - Wang JW,Schwab R,Czech B,Mica E,Weigel D
Dual effects of miR156-targeted SPL genes and CYP78A5/KLUH on plastochron length and organ size in Arabidopsis thaliana. Plant Cell, 2008. 20(5): p. 1231-43 [PMID:18492871] - Li LC, et al.
SPOROCYTELESS modulates YUCCA expression to regulate the development of lateral organs in Arabidopsis. New Phytol., 2008. 179(3): p. 751-64 [PMID:18557819] - Shikata M,Koyama T,Mitsuda N,Ohme-Takagi M
Arabidopsis SBP-box genes SPL10, SPL11 and SPL2 control morphological change in association with shoot maturation in the reproductive phase. Plant Cell Physiol., 2009. 50(12): p. 2133-45 [PMID:19880401] - Xing S,Salinas M,H
miR156-targeted and nontargeted SBP-box transcription factors act in concert to secure male fertility in Arabidopsis. Plant Cell, 2010. 22(12): p. 3935-50 [PMID:21177480] - Gaudinier A, et al.
Enhanced Y1H assays for Arabidopsis. Nat. Methods, 2011. 8(12): p. 1053-5 [PMID:22037706] - Jin J, et al.
An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors. Mol. Biol. Evol., 2015. 32(7): p. 1767-73 [PMID:25750178] - Wang Z,Wang Y,Kohalmi SE,Amyot L,Hannoufa A
SQUAMOSA PROMOTER BINDING PROTEIN-LIKE 2 controls floral organ development and plant fertility by activating ASYMMETRIC LEAVES 2 in Arabidopsis thaliana. Plant Mol. Biol., 2016. 92(6): p. 661-674 [PMID:27605094] - Chao LM, et al.
Arabidopsis Transcription Factors SPL1 and SPL12 Confer Plant Thermotolerance at Reproductive Stage. Mol Plant, 2017. 10(5): p. 735-748 [PMID:28400323]
|