PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

AT5G42630.1

Common Name

ATS, KAN4, MFO20.5

Organism

Arabidopsis thaliana

Taxonomic ID

3702

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis

Family

G2-like

Protein Properties

Length: 276aa MW: 30961.3 Da PI: 7.8989

Description

G2-like family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
AT5G42630.1	genome	TAIR	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	G2-like	101.7	4.7e-32	106	159	2	55
G2-like 2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 pr+rWt++LH++Fv+av+ LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+ AT5G42630.1 106 PRMRWTSTLHAHFVHAVQLLGGHERATPKSVLELMNVKDLTLAHVKSHLQMYRT 159 9****************************************************7 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SuperFamily	SSF46689	1.79E-15	103	159	IPR009057	Homeodomain-like
Gene3D	G3DSA:1.10.10.60	2.8E-28	104	159	IPR009057	Homeodomain-like
TIGRFAMs	TIGR01557	5.8E-24	106	159	IPR006447	Myb domain, plants
Pfam	PF00249	4.1E-7	107	158	IPR001005	SANT/Myb domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0030154	Biological Process	cell differentiation
GO:0080060	Biological Process	integument development
GO:0005618	Cellular Component	cell wall
GO:0005634	Cellular Component	nucleus
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0044212	Molecular Function	transcription regulatory region DNA binding

Plant Ontology ? help Back to Top
PO Term	PO Category	PO Description
PO:0000037	anatomy	shoot apex
PO:0000282	anatomy	trichome
PO:0000293	anatomy	guard cell
PO:0009005	anatomy	root
PO:0009009	anatomy	plant embryo
PO:0009010	anatomy	seed
PO:0009030	anatomy	carpel
PO:0009031	anatomy	sepal
PO:0009032	anatomy	petal
PO:0009046	anatomy	flower
PO:0009047	anatomy	stem
PO:0009052	anatomy	flower pedicel
PO:0020021	anatomy	integument
PO:0020100	anatomy	hypocotyl
PO:0025022	anatomy	collective leaf structure
PO:0001078	developmental stage	plant embryo cotyledonary stage
PO:0001185	developmental stage	plant embryo globular stage
PO:0004507	developmental stage	plant embryo bilateral stage
PO:0007611	developmental stage	petal differentiation and expansion stage
PO:0007616	developmental stage	flowering stage

Sequence ? help Back to Top
Protein Sequence Length: 276 aa Download sequence Send to blast
MMMLESRNSM RASNSVPDLS LQISLPNYHA GKPLHGGDRS STSSDSGSSL SDLSHENNFF 60 NKPLLSLGFD HHHQRRSNMF QPQIYGRDFK RSSSSMVGLK RSIRAPRMRW TSTLHAHFVH 120 AVQLLGGHER ATPKSVLELM NVKDLTLAHV KSHLQMYRTV KCTDKGSPGE GKVEKEAEQR 180 IEDNNNNEEA DEGTDTNSPN SSSVQKTQRA SWSSTKEVSR SISTQAYSHL GTTHHTKDNE 240 EKEDTNIHLN LDFTLGRPSW GMEYAEPSSD LTLLKC

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
6j4k_A	2e-16	107	161	4	58	Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B	2e-16	107	161	4	58	Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A	2e-16	107	161	3	57	Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B	2e-16	107	161	3	57	Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C	2e-16	107	161	3	57	Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D	2e-16	107	161	3	57	Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A	2e-16	107	161	4	58	Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C	2e-16	107	161	4	58	Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D	2e-16	107	161	4	58	Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F	2e-16	107	161	4	58	Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H	2e-16	107	161	4	58	Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J	2e-16	107	161	4	58	Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase

Expression -- Microarray ? help Back to Top
Source	ID	E-value
GEO	30694094	0.0
Genevisible	249206_at	0.0
Expression Atlas	AT5G42630	-
AtGenExpress	AT5G42630	-
ATTED-II	AT5G42630	-

Expression -- Description ? help Back to Top
Source	Description
Uniprot	DEVELOPMENTAL STAGE: During ovule development, first expressed in the inner integument primordium and then on the abaxial side of the inner integument. {ECO:0000269\|PubMed:16623911}.
Uniprot	TISSUE SPECIFICITY: Expressed in the periphery of the primary root apex and lateral root. {ECO:0000269\|PubMed:15286295}.

Functional Description ? help Back to Top
Source	Description
TAIR	Encodes a member of the KANADI family of putative transcription factors. Involved in integument formation during ovule development and expressed at the boundary between the inner and outer integuments. It is essential for directing laminar growth of the inner integument.Along with KAN1 and KAN2, KAN4 is involved in proper localization of PIN1 in early embryogenesis.
UniProt	Probable transcription factor that regulates carpel integuments formation. Required for the specification of polarity in the ovule inner integument. Modulates the content of flavonols and proanthocyanidin in seeds. {ECO:0000269\|PubMed:16623911, ECO:0000269\|PubMed:19054366, ECO:0000269\|PubMed:20444210}.

Function -- GeneRIF ? help Back to Top
The Arabidopsis aberrant testa shape mutant encodes a member of the KANADI family of transcription factors (previously referred to as KAN4) that plays a role in integument growth. [PMID: 16623911] The results confirm that KAN4 is a regulatory protein which modulates the content of flavonols and PA in Arabidopsis seeds. [PMID: 20444210] ATS and ETT were found to share an overlapping expression pattern during Arabidopsis ovule development and loss of either gene resulted in congenital fusion of the integuments and altered seed morphology. [PMID: 22296848] ATS inhibits gibberellic acid biosynthesis. [PMID: 27794102]

Binding Motif ? help Back to Top
Motif ID	Method	Source	Motif file
MP00107	PBM	26531826	Download

Cis-element ? help Back to Top
Source	Link
PlantRegMap	AT5G42630.1

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	Retrieve

Regulation -- ATRM (Manually Curated Target Genes) ? help Back to Top
Source	Target Gene (A: Activate/R: Repress)
ATRM	AT1G23420(R), AT1G73590(R)

Phenotype -- Disruption Phenotype ? help Back to Top
Source	Description
UniProt	DISRUPTION PHENOTYPE: Ovules with a single integument instead of two. {ECO:0000269\|PubMed:16623911}.

Phenotype -- Mutation ? help Back to Top
Source	ID
T-DNA Express	AT5G42630

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AY048691	0.0	AY048691.1 Arabidopsis thaliana GARP-like putative transcription factor KANADI4 (KAN4) mRNA, complete cds.
GenBank	BT026053	0.0	BT026053.1 Arabidopsis thaliana At5g42630 mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	NP_199077.1	0.0	Homeodomain-like superfamily protein
Swissprot	Q9FJV5	0.0	KAN4_ARATH; Probable transcription factor KAN4
TrEMBL	A0A178UHG9	0.0	A0A178UHG9_ARATH; KAN4
STRING	AT5G42630.1	0.0	(Arabidopsis thaliana)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM6572	28	44
Representative plant	OGRP570	15	80

Link Out ? help Back to Top
Phytozome	AT5G42630.1
Entrez Gene	834270
iHOP	AT5G42630
wikigenes	AT5G42630

Publications ? help Back to Top
Riechmann JL, et al. Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes. Science, 2000. 290(5499): p. 2105-10 [PMID:11118137] Eshed Y,Baum SF,Perea JV,Bowman JL Establishment of polarity in lateral organs of plants. Curr. Biol., 2001. 11(16): p. 1251-60 [PMID:11525739] Leon-Kloosterziel KM,Keijzer CJ,Koornneef M A Seed Shape Mutant of Arabidopsis That Is Affected in Integument Development. Plant Cell, 1994. 6(3): p. 385-392 [PMID:12244241] Hawker NP,Bowman JL Roles for Class III HD-Zip and KANADI genes in Arabidopsis root development. Plant Physiol., 2004. 135(4): p. 2261-70 [PMID:15286295] Sieber P,Petrascheck M,Barberis A,Schneitz K Organ polarity in Arabidopsis. NOZZLE physically interacts with members of the YABBY family. Plant Physiol., 2004. 135(4): p. 2172-85 [PMID:15299139] McAbee JM, et al. ABERRANT TESTA SHAPE encodes a KANADI family member, linking polarity determination to separation and growth of Arabidopsis ovule integuments. Plant J., 2006. 46(3): p. 522-31 [PMID:16623911] Izhaki A,Bowman JL KANADI and class III HD-Zip gene families regulate embryo patterning and modulate auxin flow during embryogenesis in Arabidopsis. Plant Cell, 2007. 19(2): p. 495-508 [PMID:17307928] Kelley DR,Skinner DJ,Gasser CS Roles of polarity determinants in ovule development. Plant J., 2009. 57(6): p. 1054-64 [PMID:19054366] Skinner DJ,Gasser CS Expression-based discovery of candidate ovule development regulators through transcriptional profiling of ovule mutants. BMC Plant Biol., 2009. 9: p. 29 [PMID:19291320] Gao P, et al. A new dominant Arabidopsis transparent testa mutant, sk21-D, and modulation of seed flavonoid biosynthesis by KAN4. Plant Biotechnol. J., 2010. 8(9): p. 979-93 [PMID:20444210] Kelley DR,Arreola A,Gallagher TL,Gasser CS ETTIN (ARF3) physically interacts with KANADI proteins to form a functional complex essential for integument development and polarity determination in Arabidopsis. Development, 2012. 139(6): p. 1105-9 [PMID:22296848] Enugutti B, et al. Regulation of planar growth by the Arabidopsis AGC protein kinase UNICORN. Proc. Natl. Acad. Sci. U.S.A., 2012. 109(37): p. 15060-5 [PMID:22927420] Jin J, et al. An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors. Mol. Biol. Evol., 2015. 32(7): p. 1767-73 [PMID:25750178] Lora J,Hormaza JI,Herrero M Transition from two to one integument in Prunus species: expression pattern of INNER NO OUTER (INO), ABERRANT TESTA SHAPE (ATS) and ETTIN (ETT). New Phytol., 2015. 208(2): p. 584-95 [PMID:25991552] Skinner DJ,Brown RH,Kuzoff RK,Gasser CS Conservation of the role of INNER NO OUTER in development of unitegmic ovules of the Solanaceae despite a divergence in protein function. BMC Plant Biol., 2016. 16(1): p. 143 [PMID:27350128] Gomez MD,Ventimilla D,Sacristan R,Perez-Amador MA Gibberellins Regulate Ovule Integument Development by Interfering with the Transcription Factor ATS. Plant Physiol., 2016. 172(4): p. 2403-2415 [PMID:27794102]