PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | AT5G26630.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
|
||||||||
Family | M-type_MADS | ||||||||
Protein Properties | Length: 218aa MW: 25123.2 Da PI: 10.4182 | ||||||||
Description | M-type_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 48.3 | 1.3e-15 | 10 | 50 | 2 | 42 |
---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-T CS SRF-TF 2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifss 42 +ien++ r+ tf kR++g+lKKA+EL +LC++ + ++ s+ AT5G26630.1 10 FIENETARKSTFKKRKKGLLKKAQELGILCGVPIFAVVNSP 50 8*******************************999988876 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00432 | 6.2E-22 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS50066 | 18.166 | 1 | 49 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 4.58E-23 | 2 | 95 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 8.9E-10 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 1.6E-16 | 10 | 50 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 8.9E-10 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Plant Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PO Term | PO Category | PO Description | ||||
PO:0000005 | anatomy | cultured plant cell | ||||
PO:0000293 | anatomy | guard cell | ||||
PO:0009046 | anatomy | flower | ||||
PO:0009089 | anatomy | endosperm | ||||
PO:0007611 | developmental stage | petal differentiation and expansion stage |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 218 aa Download sequence Send to blast |
MTRQKVKMTF IENETARKST FKKRKKGLLK KAQELGILCG VPIFAVVNSP YELNPEVWPS 60 REAANQVVSQ WKTMSVMDKT KKMVNQETFL QQRITKATES WKKLRKENKE LEMKNIMFDC 120 LSGKTLVSSI EKTELRDFGY VIEQQLKDVN RRIEILKRNN EPSSALVPVA APTTSSVMPV 180 VEMGSSSVGF YDKVRDQIQI TLNMKQTTND LDLNKKQW |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 21 | 25 | KKRKK |
Expression -- Microarray ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | E-value | ||||
Genevisible | 246834_at | 0.0 | ||||
Expression Atlas | AT5G26630 | - | ||||
AtGenExpress | AT5G26630 | - | ||||
ATTED-II | AT5G26630 | - |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in the central cell of the female gametophyte and in early endosperm. Also detected in ovaries, young siliques, roots, leaves, stems, young flowers and anthers. {ECO:0000269|PubMed:16798889}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor. Controls central cell differentiation during female gametophyte development. Required for the expression of DEMETER and DD46, but not for the expression of FIS2 (PubMed:16798889). Probable transcription factor that may function in the maintenance of the proper function of the central cell in pollen tube attraction (Probable). {ECO:0000269|PubMed:16798889, ECO:0000305|PubMed:26462908}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | AT5G26630.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Phenotype -- Mutation ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | |||||
T-DNA Express | AT5G26630 |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AY141246 | 0.0 | AY141246.1 Arabidopsis thaliana MADS-box protein AGL35 mRNA, complete cds. | |||
GenBank | CP002688 | 0.0 | CP002688.1 Arabidopsis thaliana chromosome 5 sequence. | |||
GenBank | F21E10 | 0.0 | AF058914.1 Arabidopsis thaliana BAC F21E10, complete sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_850882.2 | 1e-159 | MADS-box transcription factor family protein | ||||
Swissprot | Q9FJK3 | 5e-54 | AGL80_ARATH; Agamous-like MADS-box protein AGL80 | ||||
TrEMBL | Q7XJK7 | 1e-158 | Q7XJK7_ARATH; MADS-box protein AGL35 | ||||
STRING | AT5G26630.1 | 1e-159 | (Arabidopsis thaliana) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM70 | 28 | 415 | Representative plant | OGRP114 | 13 | 173 |
Link Out ? help Back to Top | |
---|---|
Phytozome | AT5G26630.1 |
Entrez Gene | 832726 |
iHOP | AT5G26630 |
wikigenes | AT5G26630 |