PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

AT5G23000.1

Common Name

ATMYB37, MYB37, RAX1, T20O7.2

Organism

Arabidopsis thaliana

Taxonomic ID

3702

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis

Family

MYB

Protein Properties

Length: 329aa MW: 37045.4 Da PI: 8.6791

Description

myb domain protein 37

Gene Model

Gene Model ID	Type	Source	Coding Sequence
AT5G23000.1	genome	TAIR	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	48	2.8e-15	14	62	1	48
TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48 rg+W++eEd +l d+++++G+g +W + + + g++R++k+c++rw++yl AT5G23000.1 14 RGPWSPEEDSKLRDYIEKYGNGgNWISFPLKAGLRRCGKSCRLRWLNYL 62 89*********************************************97 PP
2	Myb_DNA-binding	41.9	2.3e-13	69	111	2	46
SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS Myb_DNA-binding 2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 g +++eEd ++ +++ G++ W+ Ia++++ gRt++++k++w++ AT5G23000.1 69 GDFSEEEDRIIFSLFAAIGSR-WSIIAAHLP-GRTDNDIKNYWNT 111 789****************.*****.*********97 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51294	13.082	9	62	IPR017930	Myb domain
SuperFamily	SSF46689	3.27E-27	12	109	IPR009057	Homeodomain-like
SMART	SM00717	7.7E-10	13	64	IPR001005	SANT/Myb domain
Pfam	PF00249	5.1E-14	14	62	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	9.1E-23	15	69	IPR009057	Homeodomain-like
CDD	cd00167	1.43E-8	16	62	No hit	No description
PROSITE profile	PS51294	23.362	63	117	IPR017930	Myb domain
SMART	SM00717	1.7E-13	67	115	IPR001005	SANT/Myb domain
Pfam	PF00249	2.5E-12	69	111	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	1.5E-23	70	117	IPR009057	Homeodomain-like
CDD	cd00167	4.62E-10	71	113	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006357	Biological Process	regulation of transcription from RNA polymerase II promoter
GO:0007275	Biological Process	multicellular organism development
GO:0030154	Biological Process	cell differentiation
GO:0005634	Cellular Component	nucleus
GO:0000981	Molecular Function	RNA polymerase II transcription factor activity, sequence-specific DNA binding
GO:0001135	Molecular Function	transcription factor activity, RNA polymerase II transcription factor recruiting
GO:0043565	Molecular Function	sequence-specific DNA binding
GO:0044212	Molecular Function	transcription regulatory region DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 329 aa Download sequence Send to blast
MGRAPCCDKT KVKRGPWSPE EDSKLRDYIE KYGNGGNWIS FPLKAGLRRC GKSCRLRWLN 60 YLRPNIKHGD FSEEEDRIIF SLFAAIGSRW SIIAAHLPGR TDNDIKNYWN TKLRKKLLSS 120 SSDSSSSAMA SPYLNPISQD VKRPTSPTTI PSSSYNPYAE NPNQYPTKSL ISSINGFEAG 180 DKQIISYINP NYPQDLYLSD SNNNTSNANG FLLNHNMCDQ YKNHTSFSSD VNGIRSEIMM 240 KQEEIMMMMM IDHHIDQRTK GYNGEFTQGY YNYYNGHGDL KQMISGTGTN SNINMGGSGS 300 SSSSISNLAE NKSSGSLLLE YKCLPYFYS

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1a5j_A	5e-27	14	117	7	108	B-MYB
Search in ModeBase

Expression -- Microarray ? help Back to Top
Source	ID	E-value
Genevisible	249858_at	0.0
Expression Atlas	AT5G23000	-
AtGenExpress	AT5G23000	-
ATTED-II	AT5G23000	-

Expression -- Description ? help Back to Top
Source	Description
Uniprot	DEVELOPMENTAL STAGE: Accumulates in an adaxial ball-shaped set of cells in three to five cell layers around the L3 layer of the shoot apical meristem (SAM) in youg plantlets. Later, expressed transiently at the center of the boundary between the SAM and developing leaf primordia. In the inflorescence meristem, confined to the axils of flower primordia. {ECO:0000269\|PubMed:16461581, ECO:0000269\|PubMed:16473968}.
Uniprot	TISSUE SPECIFICITY: Mostly expressed in roots. Also present in shoot tips and flower buds. {ECO:0000269\|PubMed:16461581}.

Functional Description ? help Back to Top
Source	Description
TAIR	"Putative homolog of the Blind gene in tomato. Together with RAX2 and RAX3 belong to the class R2R3 MYB genes; encoded by the Myb-like transcription factor MYB37, regulates axillary meristem formation. RAX1 is expressed in a small central domain within the boundary zone separating SAM and leaf primordia during early leaf primordium development and is currently the earliest spatial marker for future axillary meristems. Member of the R2R3 factor gene family."
UniProt	Transcription activator of genes involved in the regulation of meristematic competence, such as CUC2. Positively regulates axillary meristems (AMs) formation and development, especially at early phases of vegetative growth, probably by specifying a stem cell niche for AM formation. Modulates the negative regulation mediated by gibberellic acid on the timing of developmental phase transitions. {ECO:0000269\|PubMed:16461581, ECO:0000269\|PubMed:16473968}.

Function -- GeneRIF ? help Back to Top
rax mutants show new phenotypes that are characterized by defects in lateral bud formation in overlapping zones along the shoot axis. RAX genes are partially redundant in function and allow a fine-tuning of secondary axis formation [RAX1] [PMID: 16461581] RAX1 functions to positionally specify a stem cell niche for axillary meristem formation and affects the timing of developmental phase transitions by negatively regulating gibberellic acid levels in the shoot apex. [RAX1] [PMID: 16473968] ROX regulates axillary meristem formation redundantly with RAX1 and LAS. [PMID: 22372440] A LFY allele with reduced floral function revealed its ability to stimulate axillary meristem growth. This role requires the ability of LFY to bind DNA, and is mediated by direct induction of REGULATOR OF AXILLARY MERISTEMS1 (RAX1) by LFY. [PMID: 23445516]

Cis-element ? help Back to Top
Source	Link
PlantRegMap	AT5G23000.1

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By a shift from short days to long days, in the axils of primordia on the elongating stem. {ECO:0000269\|PubMed:16461581}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	Retrieve

Regulation -- ATRM (Manually Curated Target Genes) ? help Back to Top
Source	Target Gene (A: Activate/R: Repress)
ATRM	AT1G07890(R), AT1G19570(R), AT2G37630(A), AT4G37750(A), AT5G53950(A)

Phenotype -- Mutation ? help Back to Top
Source	ID
T-DNA Express	AT5G23000

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AK175507	0.0	AK175507.1 Arabidopsis thaliana mRNA for myb like transcription factor (MYB37), complete cds, clone: RAFL21-93-G12.
GenBank	AY519628	0.0	AY519628.1 Arabidopsis thaliana MYB transcription factor (At5g23000) mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	NP_197691.1	0.0	myb domain protein 37
Swissprot	Q9FG68	0.0	RAX1_ARATH; Transcription factor RAX1
TrEMBL	A0A178UCW3	0.0	A0A178UCW3_ARATH; RAX1
STRING	AT5G23000.1	0.0	(Arabidopsis thaliana)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM14013	16	23
Representative plant	OGRP5	17	1784

Link Out ? help Back to Top
Phytozome	AT5G23000.1
Entrez Gene	832364
iHOP	AT5G23000
wikigenes	AT5G23000

Publications ? help Back to Top
Riechmann JL, et al. Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes. Science, 2000. 290(5499): p. 2105-10 [PMID:11118137] Stracke R,Werber M,Weisshaar B The R2R3-MYB gene family in Arabidopsis thaliana. Curr. Opin. Plant Biol., 2001. 4(5): p. 447-56 [PMID:11597504] Che P,Gingerich DJ,Lall S,Howell SH Global and hormone-induced gene expression changes during shoot development in Arabidopsis. Plant Cell, 2002. 14(11): p. 2771-85 [PMID:12417700] Kroymann J,Donnerhacke S,Schnabelrauch D,Mitchell-Olds T Evolutionary dynamics of an Arabidopsis insect resistance quantitative trait locus. Proc. Natl. Acad. Sci. U.S.A., 2003. 100 Suppl 2: p. 14587-92 [PMID:14506289] Hoth S, et al. Monitoring genome-wide changes in gene expression in response to endogenous cytokinin reveals targets in Arabidopsis thaliana. FEBS Lett., 2003. 554(3): p. 373-80 [PMID:14623097] Ball L, et al. Evidence for a direct link between glutathione biosynthesis and stress defense gene expression in Arabidopsis. Plant Cell, 2004. 16(9): p. 2448-62 [PMID:15308753] Müller D,Schmitz G,Theres K Blind homologous R2R3 Myb genes control the pattern of lateral meristem initiation in Arabidopsis. Plant Cell, 2006. 18(3): p. 586-97 [PMID:16461581] Yanhui C, et al. The MYB transcription factor superfamily of Arabidopsis: expression analysis and phylogenetic comparison with the rice MYB family. Plant Mol. Biol., 2006. 60(1): p. 107-24 [PMID:16463103] Keller T,Abbott J,Moritz T,Doerner P Arabidopsis REGULATOR OF AXILLARY MERISTEMS1 controls a leaf axil stem cell niche and modulates vegetative development. Plant Cell, 2006. 18(3): p. 598-611 [PMID:16473968] Underwood BA,Vanderhaeghen R,Whitford R,Town CD,Hilson P Simultaneous high-throughput recombinational cloning of open reading frames in closed and open configurations. Plant Biotechnol. J., 2006. 4(3): p. 317-24 [PMID:17147637] Textor S,de Kraker JW,Hause B,Gershenzon J,Tokuhisa JG MAM3 catalyzes the formation of all aliphatic glucosinolate chain lengths in Arabidopsis. Plant Physiol., 2007. 144(1): p. 60-71 [PMID:17369439] Ehrenreich IM,Stafford PA,Purugganan MD The genetic architecture of shoot branching in Arabidopsis thaliana: a comparative assessment of candidate gene associations vs. quantitative trait locus mapping. Genetics, 2007. 176(2): p. 1223-36 [PMID:17435248] Jeifetz D,David-Schwartz R,Borovsky Y,Paran I CaBLIND regulates axillary meristem initiation and transition to flowering in pepper. Planta, 2011. 234(6): p. 1227-36 [PMID:21773792] Busch BL, et al. Shoot branching and leaf dissection in tomato are regulated by homologous gene modules. Plant Cell, 2011. 23(10): p. 3595-609 [PMID:22039213] Yang F,Wang Q,Schmitz G,M The bHLH protein ROX acts in concert with RAX1 and LAS to modulate axillary meristem formation in Arabidopsis. Plant J., 2012. 71(1): p. 61-70 [PMID:22372440] Chahtane H, et al. A variant of LEAFY reveals its capacity to stimulate meristem development by inducing RAX1. Plant J., 2013. 74(4): p. 678-89 [PMID:23445516] Schnaubelt D,Schulz P,Hannah MA,Yocgo RE,Foyer CH A phenomics approach to the analysis of the influence of glutathione on leaf area and abiotic stress tolerance in Arabidopsis thaliana. Front Plant Sci, 2013. 4: p. 416 [PMID:24204368] Jin J, et al. An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors. Mol. Biol. Evol., 2015. 32(7): p. 1767-73 [PMID:25750178] Guo D, et al. The WRKY Transcription Factor WRKY71/EXB1 Controls Shoot Branching by Transcriptionally Regulating RAX Genes in Arabidopsis. Plant Cell, 2015. 27(11): p. 3112-27 [PMID:26578700] Yu YT, et al. Overexpression of the MYB37 transcription factor enhances abscisic acid sensitivity, and improves both drought tolerance and seed productivity in Arabidopsis thaliana. Plant Mol. Biol., 2016. 90(3): p. 267-79 [PMID:26646286] Kranz HD, et al. Towards functional characterisation of the members of the R2R3-MYB gene family from Arabidopsis thaliana. Plant J., 1998. 16(2): p. 263-76 [PMID:9839469]