Signature Domain? help Back to Top |
|
No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
1 | SBP | 114.1 | 8e-36 | 137 | 213 | 1 | 77 |
--SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
SBP 1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77
+Cqv++Cead+se+k yh+rh+vC ++ a+ v+++g+++r+CqqC++fh l +fDe+krsCrr+L++hn+rr++k
AT5G18830.2 137 RCQVPDCEADISELKGYHKRHRVCLRCATASFVVLDGENKRYCQQCGKFHLLPDFDEGKRSCRRKLERHNNRRKRKP 213
6************************************************************************9975 PP
|
Function -- GeneRIF ? help
Back to Top |
- SPL7 activates the transcription of multiple genes involved in copper homeostasis.[PMID: 19122104]
- Cu uptake into roots of Cu-deficient plants is dependent on FRO4/FRO5 and SPL7.[PMID: 22374396]
- COPT6 expression is regulated by copper availability that, in part, is controlled by a master regulator of copper homeostasis, SPL7[PMID: 22865877]
- SPL7 directly regulates miR408 expression.[PMID: 23289771]
- Data suggest that iron superoxide dismutase gene FSD1 and SPL7 transcriptional regulator SPL7 may associate withi copper homeostasis.[PMID: 23455955]
- Data indicate that cadmium (Cd) elicits SPL7-dependent copper (Cu) deficiency responses by altering expression of COPT1, COPT2, COPT6, CSD1, CSD2, miRNA398 b/c precursors and FSD1.[PMID: 23835944]
- The data presented here provide evidence for SPL7 and KIN17 protein interaction as a point of convergence in response to both Copper deficiency and oxidative stress.[PMID: 24335506]
- Cytological and biochemical approaches confirmed an operative transmembrane domain (TMD) and uncovered a dual localisation of SPL7 between the nucleus and an endomembrane system, most likely the endoplasmic reticulum (ER).[PMID: 25207797]
- The expression of SPL7 and its targets COPT2 and FSD1 was differently regulated in various light signalling mutants. Under copper deficiency, the expression of both targets decreased drastically in continuous darkness.[PMID: 26516126]
- CITF1 and SPL7 regulate Cu uptake and delivery to anthers, thereby influencing fertility, and highlight the relationship between Cu homeostasis, CITF1, SPL7, and the jasmonic acid metabolic pathway.[PMID: 29114014]
- In a series of grafting experiments using spl7 mutant and wild-type (WT) plants, expression of Cu-responsive microRNAs and the resulting suppression of CSD1 and CSD2 mRNAs were observed in leaves only when the aerial part was from WT plants, in which a low level of SPL7 was transcribed also in the vascular tissues.[PMID: 29635212]
|
Publications
? help Back to Top |
- Cardon G, et al.
Molecular characterisation of the Arabidopsis SBP-box genes. Gene, 1999. 237(1): p. 91-104 [PMID:10524240] - Riechmann JL, et al.
Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes. Science, 2000. 290(5499): p. 2105-10 [PMID:11118137] - Yamada K, et al.
Empirical analysis of transcriptional activity in the Arabidopsis genome. Science, 2003. 302(5646): p. 842-6 [PMID:14593172] - Kamada T, et al.
Functional differentiation of peroxisomes revealed by expression profiles of peroxisomal genes in Arabidopsis thaliana. Plant Cell Physiol., 2003. 44(12): p. 1275-89 [PMID:14701923] - Yamasaki K, et al.
A novel zinc-binding motif revealed by solution structures of DNA-binding domains of Arabidopsis SBP-family transcription factors. J. Mol. Biol., 2004. 337(1): p. 49-63 [PMID:15001351] - Kropat J, et al.
A regulator of nutritional copper signaling in Chlamydomonas is an SBP domain protein that recognizes the GTAC core of copper response element. Proc. Natl. Acad. Sci. U.S.A., 2005. 102(51): p. 18730-5 [PMID:16352720] - Wang Y, et al.
Transcriptome analyses show changes in gene expression to accompany pollen germination and tube growth in Arabidopsis. Plant Physiol., 2008. 148(3): p. 1201-11 [PMID:18775970] - Yamasaki H,Hayashi M,Fukazawa M,Kobayashi Y,Shikanai T
SQUAMOSA Promoter Binding Protein-Like7 Is a Central Regulator for Copper Homeostasis in Arabidopsis. Plant Cell, 2009. 21(1): p. 347-61 [PMID:19122104] - Pilon M,Cohu CM,Ravet K,Abdel-Ghany SE,Gaymard F
Essential transition metal homeostasis in plants. Curr. Opin. Plant Biol., 2009. 12(3): p. 347-57 [PMID:19481497] - Pe
Regulation of copper transport in Arabidopsis thaliana: a biochemical oscillator? J. Biol. Inorg. Chem., 2010. 15(1): p. 29-36 [PMID:19798519] - Cohu CM, et al.
Copper delivery by the copper chaperone for chloroplast and cytosolic copper/zinc-superoxide dismutases: regulation and unexpected phenotypes in an Arabidopsis mutant. Mol Plant, 2009. 2(6): p. 1336-50 [PMID:19969519] - Bernal M, et al.
Transcriptome sequencing identifies SPL7-regulated copper acquisition genes FRO4/FRO5 and the copper dependence of iron homeostasis in Arabidopsis. Plant Cell, 2012. 24(2): p. 738-61 [PMID:22374396] - Ren L,Tang G
Identification of sucrose-responsive microRNAs reveals sucrose-regulated copper accumulations in an SPL7-dependent and independent manner in Arabidopsis thaliana. Plant Sci., 2012. 187: p. 59-68 [PMID:22404833] - Jung HI, et al.
COPT6 is a plasma membrane transporter that functions in copper homeostasis in Arabidopsis and is a novel target of SQUAMOSA promoter-binding protein-like 7. J. Biol. Chem., 2012. 287(40): p. 33252-67 [PMID:22865877] - Zhang H,Li L
SQUAMOSA promoter binding protein-like7 regulated microRNA408 is required for vegetative development in Arabidopsis. Plant J., 2013. 74(1): p. 98-109 [PMID:23289771] - Andr
Comparison of global responses to mild deficiency and excess copper levels in Arabidopsis seedlings. Metallomics, 2013. 5(9): p. 1234-46 [PMID:23455955] - Gayomba SR, et al.
The CTR/COPT-dependent copper uptake and SPL7-dependent copper deficiency responses are required for basal cadmium tolerance in A. thaliana. Metallomics, 2013. 5(9): p. 1262-75 [PMID:23835944] - Garcia-Molina A,Xing S,Huijser P
A conserved KIN17 curved DNA-binding domain protein assembles with SQUAMOSA PROMOTER-BINDING PROTEIN-LIKE7 to adapt Arabidopsis growth and development to limiting copper availability. Plant Physiol., 2014. 164(2): p. 828-40 [PMID:24335506] - Garcia-Molina A,Xing S,Huijser P
Functional characterisation of Arabidopsis SPL7 conserved protein domains suggests novel regulatory mechanisms in the Cu deficiency response. BMC Plant Biol., 2014. 14: p. 231 [PMID:25207797] - Zhang H, et al.
MicroRNA408 is critical for the HY5-SPL7 gene network that mediates the coordinated response to light and copper. Plant Cell, 2014. 26(12): p. 4933-53 [PMID:25516599] - Jin J, et al.
An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors. Mol. Biol. Evol., 2015. 32(7): p. 1767-73 [PMID:25750178] - Zhao Y, et al.
MicroRNA857 Is Involved in the Regulation of Secondary Growth of Vascular Tissues in Arabidopsis. Plant Physiol., 2015. 169(4): p. 2539-52 [PMID:26511915] - Perea-GarcĂa A, et al.
Modulation of copper deficiency responses by diurnal and circadian rhythms in Arabidopsis thaliana. J. Exp. Bot., 2016. 67(1): p. 391-403 [PMID:26516126] - Gielen H,Remans T,Vangronsveld J,Cuypers A
Toxicity responses of Cu and Cd: the involvement of miRNAs and the transcription factor SPL7. BMC Plant Biol., 2016. 16(1): p. 145 [PMID:27352843] - Yan J, et al.
Arabidopsis Pollen Fertility Requires the Transcription Factors CITF1 and SPL7 That Regulate Copper Delivery to Anthers and Jasmonic Acid Synthesis. Plant Cell, 2017. 29(12): p. 3012-3029 [PMID:29114014] - Araki R, et al.
SPL7 locally regulates copper-homeostasis-related genes in Arabidopsis. J. Plant Physiol., 2018. [PMID:29635212]
|