PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT5G17810.1
Common NameMVA3.160, MVA3.17, WOX12
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family WOX
Protein Properties Length: 268aa    MW: 29713.9 Da    PI: 6.5705
Description WUSCHEL related homeobox 12
Gene Model
Gene Model ID Type Source Coding Sequence
AT5G17810.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox49.38.2e-161979257
                 T--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
     Homeobox  2 rkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
                 r R+++++eq+ +Le+ F++ + +p ++e  ++ k l     + +++V++WFqNrR + ++
  AT5G17810.1 19 RARWSPKPEQILILESIFNSgTVNPPKDETVRIRKMLekfgAVGDANVFYWFQNRRSRSRR 79
                 78*****************99*************************************997 PP

2Wus_type_Homeobox105.34e-341881265
  Wus_type_Homeobox  2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65
                       +r+RW+P+peQi iLe++++sG+++P+k+e+ ri+++Le++G+++d+NVfyWFQNr++R+r+++
        AT5G17810.1 18 VRARWSPKPEQILILESIFNSGTVNPPKDETVRIRKMLEKFGAVGDANVFYWFQNRRSRSRRRH 81
                       589**********************************************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.58E-141085IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.2E-81484IPR009057Homeodomain-like
PROSITE profilePS5007111.5151580IPR001356Homeobox domain
SMARTSM003898.5E-61784IPR001356Homeobox domain
PfamPF000461.9E-131979IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048830Biological Processadventitious root development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 268 aa     Download sequence    Send to blast
MNQEGASHSP SSTSTEPVRA RWSPKPEQIL ILESIFNSGT VNPPKDETVR IRKMLEKFGA  60
VGDANVFYWF QNRRSRSRRR HRQLLAATTA AATSIGAEDH QHMTAMSMHQ YPCSNNEIDL  120
GFGSCSNLSA NYFLNGSSSS QIPSFFLGLS SSSGGCENNN GMENLFKMYG HESDHNHQQQ  180
HHSSNAASVL NPSDQNSNSQ YEQEGFMTVF INGVPMEVTK GAIDMKTMFG DDSVLLHSSG  240
LPLPTDEFGF LMHSLQHGQT YFLVPRQT
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasAT5G17810
AtGenExpressAT5G17810
Functional Description ? help Back to Top
Source Description
TAIREncodes a WUSCHEL-related homeobox gene family member with 65 amino acids in its homeodomain. Proteins in this family contain a sequence of eight residues (TLPLFPMH) downstream of the homeodomain called the WUS box.
UniProtTranscription factor which may be involved in developmental processes. {ECO:0000250}.
Function -- GeneRIF ? help Back to Top
  1. WOX11 directly responds to a wounding-induced auxin maximum in and surrounding the procambium and acts redundantly with its homolog WOX12 to upregulate LATERAL ORGAN BOUNDARIES DOMAIN16 (LBD16) and LBD29
    [PMID: 24642937]
  2. the expression switch from WOX11/12 to WOX5/7 is critical for initiation of the root primordium during de novo root organogenesis.
    [PMID: 27784768]
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT5G17810.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Interaction ? help Back to Top
Source Intact With
IntActSearch Q8GY25
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT5G17810
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY2514030.0AY251403.1 Arabidopsis thaliana WOX12 protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001190327.10.0WUSCHEL related homeobox 12
RefseqNP_197283.20.0WUSCHEL related homeobox 12
SwissprotQ8GY250.0WOX12_ARATH; WUSCHEL-related homeobox 12
TrEMBLA0A178U9950.0A0A178U995_ARATH; WOX12
STRINGAT5G17810.20.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM28192768
Representative plantOGRP46971222
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Seki M, et al.
    Functional annotation of a full-length Arabidopsis cDNA collection.
    Science, 2002. 296(5565): p. 141-5
    [PMID:11910074]
  3. R
    Rapid identification of Arabidopsis insertion mutants by non-radioactive detection of T-DNA tagged genes.
    Plant J., 2002. 32(2): p. 243-53
    [PMID:12383089]
  4. Yamada K, et al.
    Empirical analysis of transcriptional activity in the Arabidopsis genome.
    Science, 2003. 302(5646): p. 842-6
    [PMID:14593172]
  5. Haecker A, et al.
    Expression dynamics of WOX genes mark cell fate decisions during early embryonic patterning in Arabidopsis thaliana.
    Development, 2004. 131(3): p. 657-68
    [PMID:14711878]
  6. Wu X,Chory J,Weigel D
    Combinations of WOX activities regulate tissue proliferation during Arabidopsis embryonic development.
    Dev. Biol., 2007. 309(2): p. 306-16
    [PMID:17706632]
  7. Hirakawa Y,Kondo Y,Fukuda H
    TDIF peptide signaling regulates vascular stem cell proliferation via the WOX4 homeobox gene in Arabidopsis.
    Plant Cell, 2010. 22(8): p. 2618-29
    [PMID:20729381]
  8. Zhang X,Zong J,Liu J,Yin J,Zhang D
    Genome-wide analysis of WOX gene family in rice, sorghum, maize, Arabidopsis and poplar.
    J Integr Plant Biol, 2010. 52(11): p. 1016-26
    [PMID:20977659]
  9. Arabidopsis Interactome Mapping Consortium
    Evidence for network evolution in an Arabidopsis interactome map.
    Science, 2011. 333(6042): p. 601-7
    [PMID:21798944]
  10. Liu J, et al.
    WOX11 and 12 are involved in the first-step cell fate transition during de novo root organogenesis in Arabidopsis.
    Plant Cell, 2014. 26(3): p. 1081-93
    [PMID:24642937]
  11. Hu X,Xu L
    Transcription Factors WOX11/12 Directly Activate WOX5/7 to Promote Root Primordia Initiation and Organogenesis.
    Plant Physiol., 2016. 172(4): p. 2363-2373
    [PMID:27784768]