PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

AT5G07700.1

Common Name

AtMYB76, HAG2, MBK20.16, MYB76

Organism

Arabidopsis thaliana

Taxonomic ID

3702

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis

Family

MYB

Protein Properties

Length: 338aa MW: 38194.4 Da PI: 5.1711

Description

myb domain protein 76

Gene Model

Gene Model ID	Type	Source	Coding Sequence
AT5G07700.1	genome	TAIR	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	56.8	5.2e-18	14	61	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+WTteEd++l+ +++ +G g W+ I+++ g++R++k+c++rw +yl AT5G07700.1 14 KGAWTTEEDKKLISYIHDHGEGGWRDIPEKAGLKRCGKSCRLRWTNYL 61 79********************************************97 PP
2	Myb_DNA-binding	46.8	6.9e-15	67	112	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg ++ eE+++++ +++ G++ W+ Iar+++ +Rt++++k++w+++l AT5G07700.1 67 RGEFSYEEEQIIIMLHASRGNK-WSVIARHLP-KRTDNEVKNYWNTHL 112 899*****************.*****.**********996 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.10.60	2.4E-23	8	64	IPR009057	Homeodomain-like
PROSITE profile	PS51294	24.084	9	65	IPR017930	Myb domain
SuperFamily	SSF46689	2.36E-28	11	108	IPR009057	Homeodomain-like
SMART	SM00717	2.6E-14	13	63	IPR001005	SANT/Myb domain
Pfam	PF00249	1.1E-16	14	61	IPR001005	SANT/Myb domain
CDD	cd00167	4.77E-11	16	61	No hit	No description
Gene3D	G3DSA:1.10.10.60	5.1E-25	65	116	IPR009057	Homeodomain-like
PROSITE profile	PS51294	18.776	66	116	IPR017930	Myb domain
SMART	SM00717	2.2E-13	66	114	IPR001005	SANT/Myb domain
Pfam	PF00249	1.9E-13	67	112	IPR001005	SANT/Myb domain
CDD	cd00167	7.18E-10	69	112	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006357	Biological Process	regulation of transcription from RNA polymerase II promoter
GO:0009414	Biological Process	response to water deprivation
GO:0009611	Biological Process	response to wounding
GO:0009625	Biological Process	response to insect
GO:0009733	Biological Process	response to auxin
GO:0009753	Biological Process	response to jasmonic acid
GO:0010439	Biological Process	regulation of glucosinolate biosynthetic process
GO:0030154	Biological Process	cell differentiation
GO:0005634	Cellular Component	nucleus
GO:0000981	Molecular Function	RNA polymerase II transcription factor activity, sequence-specific DNA binding
GO:0001135	Molecular Function	transcription factor activity, RNA polymerase II transcription factor recruiting
GO:0043565	Molecular Function	sequence-specific DNA binding
GO:0044212	Molecular Function	transcription regulatory region DNA binding

Plant Ontology ? help Back to Top
PO Term	PO Category	PO Description
PO:0000293	anatomy	guard cell
PO:0009046	anatomy	flower
PO:0020100	anatomy	hypocotyl
PO:0007611	developmental stage	petal differentiation and expansion stage

Sequence ? help Back to Top
Protein Sequence Length: 338 aa Download sequence Send to blast
MSKRPYCIGE GLKKGAWTTE EDKKLISYIH DHGEGGWRDI PEKAGLKRCG KSCRLRWTNY 60 LKPDIKRGEF SYEEEQIIIM LHASRGNKWS VIARHLPKRT DNEVKNYWNT HLKKRLIDDG 120 IDPVTHKPLA SSNPNPVEPM KFDFQKKSNQ DEHSSQSSST TPASLPLSSN LNSVKSKISS 180 GETQIESGHV SCKKRFGRSS STSRLLNKVA ARASSIGNIL STSIEGTLRS PASSSGLPDS 240 FSQSYEYMID NKEDLGTSID LNIPEYDFPQ FLEQLINDDD ENENIVGPEQ DLLMSDFPST 300 FVDEDDILGD ITSWSTYLLD HPNFMYESDQ DSDEKNFL

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1h8a_C	3e-24	12	116	25	128	MYB TRANSFORMING PROTEIN
Search in ModeBase

Expression -- Microarray ? help Back to Top
Source	ID	E-value
GEO	5823316	0.0
Genevisible	250589_at	0.0
Expression Atlas	AT5G07700	-
AtGenExpress	AT5G07700	-
ATTED-II	AT5G07700	-

Expression -- Description ? help Back to Top
Source	Description
Uniprot	DEVELOPMENTAL STAGE: Primarily present around the midvein in seedlings. Accumulates gradually in expanding leaves, reaching a maximum in fully expanded leaves in both primary and secondary veins. {ECO:0000269\|PubMed:18042203}.
Uniprot	TISSUE SPECIFICITY: Expressed in both vegetative and generative organs. Mostly present in inflorescences, flowers and seedlings, in the transition zone between roots and the foliar part, and stems, and, to a lower extent, in leaves (in midvein and trichomes). {ECO:0000269\|PubMed:18042203, ECO:0000269\|PubMed:23115560}.

Functional Description ? help Back to Top
Source	Description
TAIR	Encodes a putative transcription factor (MYB76).
UniProt	Plays a role in determining the spatial distribution of aliphatic glucosinolates (AGLSs) within the leaf, mostly short chained. Together with MYB28/HAG1 and MYB29/HAG3, promotes aliphatic glucosinolate biosynthesis and represses indolic glucosinolate biosynthesis, but could not activate AGSL biosynthesis on its own. {ECO:0000269\|PubMed:18042203, ECO:0000269\|PubMed:20348214, ECO:0000269\|PubMed:23792303, ECO:0000269\|PubMed:23943862}.

Function -- GeneRIF ? help Back to Top
HAG1/MYB28, HAG2/MYB76 and HAG3/MYB29 reciprocally transactivated each other in the control of aliphatic glucosinolate biosynthesis and downregulated the expression of genes involved in the control of indolic glucosinolate biosynthesis. [PMID: 18042203] not dependent on MYB28 and MYB29 for induction of aliphatic glucosinolates, plays a role in determining the spatial distribution of aliphatic glucosinolates within the leaf [PMID: 20348214] MYB28 expression was induced by sulfur deficiency, while the expression levels of MYB29 and MYB76 were positively correlated with sulfur concentration. [PMID: 23792303]

Cis-element ? help Back to Top
Source	Link
PlantRegMap	AT5G07700.1

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Slightly induced by auxin (IAA) and jasmonic acid (JA). Accumulates upon mechanical stimuli (e.g. wounding) in inflorescence. Down-regulated by sulfur-deficient stress. {ECO:0000269\|PubMed:16463103, ECO:0000269\|PubMed:18042203, ECO:0000269\|PubMed:23792303}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	Retrieve

Regulation -- ATRM (Manually Curated Target Genes) ? help Back to Top
Source	Target Gene (A: Activate/R: Repress)
ATRM	AT5G23010(A)

Regulation -- Hormone ? help Back to Top
Source	Hormone
AHD	auxin, jasmonic acid

Interaction ? help Back to Top
Source	Intact With
BioGRID	AT5G46760, AT5G46830, AT1G32640

Phenotype -- Mutation ? help Back to Top
Source	ID
T-DNA Express	AT5G07700

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AF175992	0.0	AF175992.1 Arabidopsis thaliana putative transcription factor (MYB76) mRNA, complete cds.
GenBank	DQ446930	0.0	DQ446930.1 Arabidopsis thaliana clone pENTR221-At5g07700 myb family transcription factor (At5g07700) mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	NP_001318501.1	0.0	myb domain protein 76
Refseq	NP_196387.1	0.0	myb domain protein 76
Swissprot	Q9SPG5	0.0	MYB76_ARATH; Transcription factor MYB76
TrEMBL	A0A178UB51	0.0	A0A178UB51_ARATH; MYB76
STRING	AT5G07700.1	0.0	(Arabidopsis thaliana)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM3787	18	60
Representative plant	OGRP5	17	1784

Link Out ? help Back to Top
Phytozome	AT5G07700.1
Entrez Gene	830663
iHOP	AT5G07700
wikigenes	AT5G07700

Publications ? help Back to Top
Riechmann JL, et al. Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes. Science, 2000. 290(5499): p. 2105-10 [PMID:11118137] Stracke R,Werber M,Weisshaar B The R2R3-MYB gene family in Arabidopsis thaliana. Curr. Opin. Plant Biol., 2001. 4(5): p. 447-56 [PMID:11597504] Yanhui C, et al. The MYB transcription factor superfamily of Arabidopsis: expression analysis and phylogenetic comparison with the rice MYB family. Plant Mol. Biol., 2006. 60(1): p. 107-24 [PMID:16463103] Underwood BA,Vanderhaeghen R,Whitford R,Town CD,Hilson P Simultaneous high-throughput recombinational cloning of open reading frames in closed and open configurations. Plant Biotechnol. J., 2006. 4(3): p. 317-24 [PMID:17147637] Gigolashvili T,Engqvist M,Yatusevich R,Müller C,Flügge UI HAG2/MYB76 and HAG3/MYB29 exert a specific and coordinated control on the regulation of aliphatic glucosinolate biosynthesis in Arabidopsis thaliana. New Phytol., 2008. 177(3): p. 627-42 [PMID:18042203] S A systems biology approach identifies a R2R3 MYB gene subfamily with distinct and overlapping functions in regulation of aliphatic glucosinolates. PLoS ONE, 2007. 2(12): p. e1322 [PMID:18094747] Malitsky S, et al. The transcript and metabolite networks affected by the two clades of Arabidopsis glucosinolate biosynthesis regulators. Plant Physiol., 2008. 148(4): p. 2021-49 [PMID:18829985] S A complex interplay of three R2R3 MYB transcription factors determines the profile of aliphatic glucosinolates in Arabidopsis. Plant Physiol., 2010. 153(1): p. 348-63 [PMID:20348214] Stotz HU, et al. Role of camalexin, indole glucosinolates, and side chain modification of glucosinolate-derived isothiocyanates in defense of Arabidopsis against Sclerotinia sclerotiorum. Plant J., 2011. 67(1): p. 81-93 [PMID:21418358] Frerigmann H,B Glucosinolates are produced in trichomes of Arabidopsis thaliana. Front Plant Sci, 2012. 3: p. 242 [PMID:23115560] Mewis I,Khan MA,Glawischnig E,Schreiner M,Ulrichs C Water stress and aphid feeding differentially influence metabolite composition in Arabidopsis thaliana (L.). PLoS ONE, 2012. 7(11): p. e48661 [PMID:23144921] Li Y, et al. Novel insights into the function of Arabidopsis R2R3-MYB transcription factors regulating aliphatic glucosinolate biosynthesis. Plant Cell Physiol., 2013. 54(8): p. 1335-44 [PMID:23792303] Schweizer F, et al. Arabidopsis basic helix-loop-helix transcription factors MYC2, MYC3, and MYC4 regulate glucosinolate biosynthesis, insect performance, and feeding behavior. Plant Cell, 2013. 25(8): p. 3117-32 [PMID:23943862] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Frerigmann H,Berger B,Gigolashvili T bHLH05 is an interaction partner of MYB51 and a novel regulator of glucosinolate biosynthesis in Arabidopsis. Plant Physiol., 2014. 166(1): p. 349-69 [PMID:25049362] Frerigmann H,Gigolashvili T Update on the role of R2R3-MYBs in the regulation of glucosinolates upon sulfur deficiency. Front Plant Sci, 2014. 5: p. 626 [PMID:25426131] Jin J, et al. An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors. Mol. Biol. Evol., 2015. 32(7): p. 1767-73 [PMID:25750178] Bulgakov VP,Veremeichik GN,Grigorchuk VP,Rybin VG,Shkryl YN The rolB gene activates secondary metabolism in Arabidopsis calli via selective activation of genes encoding MYB and bHLH transcription factors. Plant Physiol. Biochem., 2016. 102: p. 70-9 [PMID:26913794] Li B, et al. Network-Guided Discovery of Extensive Epistasis between Transcription Factors Involved in Aliphatic Glucosinolate Biosynthesis. Plant Cell, 2018. 30(1): p. 178-195 [PMID:29317470] Kranz HD, et al. Towards functional characterisation of the members of the R2R3-MYB gene family from Arabidopsis thaliana. Plant J., 1998. 16(2): p. 263-76 [PMID:9839469]