Signature Domain? help Back to Top |
|
No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
1 | Myb_DNA-binding | 56.8 | 5.2e-18 | 14 | 61 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
+g+WTteEd++l+ +++ +G g W+ I+++ g++R++k+c++rw +yl
AT5G07700.1 14 KGAWTTEEDKKLISYIHDHGEGGWRDIPEKAGLKRCGKSCRLRWTNYL 61
79********************************************97 PP
|
2 | Myb_DNA-binding | 46.8 | 6.9e-15 | 67 | 112 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
rg ++ eE+++++ +++ G++ W+ Iar+++ +Rt++++k++w+++l
AT5G07700.1 67 RGEFSYEEEQIIIMLHASRGNK-WSVIARHLP-KRTDNEVKNYWNTHL 112
899*******************.*********.************996 PP
|
Publications
? help Back to Top |
- Riechmann JL, et al.
Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes. Science, 2000. 290(5499): p. 2105-10 [PMID:11118137] - Stracke R,Werber M,Weisshaar B
The R2R3-MYB gene family in Arabidopsis thaliana. Curr. Opin. Plant Biol., 2001. 4(5): p. 447-56 [PMID:11597504] - Yanhui C, et al.
The MYB transcription factor superfamily of Arabidopsis: expression analysis and phylogenetic comparison with the rice MYB family. Plant Mol. Biol., 2006. 60(1): p. 107-24 [PMID:16463103] - Underwood BA,Vanderhaeghen R,Whitford R,Town CD,Hilson P
Simultaneous high-throughput recombinational cloning of open reading frames in closed and open configurations. Plant Biotechnol. J., 2006. 4(3): p. 317-24 [PMID:17147637] - Gigolashvili T,Engqvist M,Yatusevich R,Müller C,Flügge UI
HAG2/MYB76 and HAG3/MYB29 exert a specific and coordinated control on the regulation of aliphatic glucosinolate biosynthesis in Arabidopsis thaliana. New Phytol., 2008. 177(3): p. 627-42 [PMID:18042203] - S
A systems biology approach identifies a R2R3 MYB gene subfamily with distinct and overlapping functions in regulation of aliphatic glucosinolates. PLoS ONE, 2007. 2(12): p. e1322 [PMID:18094747] - Malitsky S, et al.
The transcript and metabolite networks affected by the two clades of Arabidopsis glucosinolate biosynthesis regulators. Plant Physiol., 2008. 148(4): p. 2021-49 [PMID:18829985] - S
A complex interplay of three R2R3 MYB transcription factors determines the profile of aliphatic glucosinolates in Arabidopsis. Plant Physiol., 2010. 153(1): p. 348-63 [PMID:20348214] - Stotz HU, et al.
Role of camalexin, indole glucosinolates, and side chain modification of glucosinolate-derived isothiocyanates in defense of Arabidopsis against Sclerotinia sclerotiorum. Plant J., 2011. 67(1): p. 81-93 [PMID:21418358] - Frerigmann H,B
Glucosinolates are produced in trichomes of Arabidopsis thaliana. Front Plant Sci, 2012. 3: p. 242 [PMID:23115560] - Mewis I,Khan MA,Glawischnig E,Schreiner M,Ulrichs C
Water stress and aphid feeding differentially influence metabolite composition in Arabidopsis thaliana (L.). PLoS ONE, 2012. 7(11): p. e48661 [PMID:23144921] - Li Y, et al.
Novel insights into the function of Arabidopsis R2R3-MYB transcription factors regulating aliphatic glucosinolate biosynthesis. Plant Cell Physiol., 2013. 54(8): p. 1335-44 [PMID:23792303] - Schweizer F, et al.
Arabidopsis basic helix-loop-helix transcription factors MYC2, MYC3, and MYC4 regulate glucosinolate biosynthesis, insect performance, and feeding behavior. Plant Cell, 2013. 25(8): p. 3117-32 [PMID:23943862] - Ding Y, et al.
Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] - Frerigmann H,Berger B,Gigolashvili T
bHLH05 is an interaction partner of MYB51 and a novel regulator of glucosinolate biosynthesis in Arabidopsis. Plant Physiol., 2014. 166(1): p. 349-69 [PMID:25049362] - Frerigmann H,Gigolashvili T
Update on the role of R2R3-MYBs in the regulation of glucosinolates upon sulfur deficiency. Front Plant Sci, 2014. 5: p. 626 [PMID:25426131] - Jin J, et al.
An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors. Mol. Biol. Evol., 2015. 32(7): p. 1767-73 [PMID:25750178] - Bulgakov VP,Veremeichik GN,Grigorchuk VP,Rybin VG,Shkryl YN
The rolB gene activates secondary metabolism in Arabidopsis calli via selective activation of genes encoding MYB and bHLH transcription factors. Plant Physiol. Biochem., 2016. 102: p. 70-9 [PMID:26913794] - Li B, et al.
Network-Guided Discovery of Extensive Epistasis between Transcription Factors Involved in Aliphatic Glucosinolate Biosynthesis. Plant Cell, 2018. 30(1): p. 178-195 [PMID:29317470] - Kranz HD, et al.
Towards functional characterisation of the members of the R2R3-MYB gene family from Arabidopsis thaliana. Plant J., 1998. 16(2): p. 263-76 [PMID:9839469]
|