PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT5G05770.1
Common NameWOX5A, WOX7
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family WOX
Protein Properties Length: 122aa    MW: 13997 Da    PI: 11.109
Description WUSCHEL related homeobox 7
Gene Model
Gene Model ID Type Source Coding Sequence
AT5G05770.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox63.82.5e-202687157
                 TT--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
     Homeobox  1 rrkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
                 ++ R+++t eq++ L +lF+   r+ps++++++++++l    +++ ++V++WFqN++a+e++
  AT5G05770.1 26 KCGRWNPTVEQVKLLTDLFKAgLRTPSTDQIQKISMELsfygKIESKNVFYWFQNHKARERQ 87
                 568*****************99**************************************97 PP

2Wus_type_Homeobox113.41.1e-362688264
  Wus_type_Homeobox  2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqk 64
                       ++ RW+Pt eQ+k+L++l+k+GlrtP++++iq+i++eL+ yGkie+kNVfyWFQN+kaRerqk
        AT5G05770.1 26 KCGRWNPTVEQVKLLTDLFKAGLRTPSTDQIQKISMELSFYGKIESKNVFYWFQNHKARERQK 88
                       578***********************************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007110.5272388IPR001356Homeobox domain
SMARTSM003898.2E-42592IPR001356Homeobox domain
SuperFamilySSF466893.72E-112591IPR009057Homeodomain-like
PfamPF000462.3E-172787IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.607.0E-82987IPR009057Homeodomain-like
CDDcd000860.001242988No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0007275Biological Processmulticellular organism development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000060anatomyroot cortex-endodermis initial cell
PO:0020127anatomyprimary root
Sequence ? help Back to Top
Protein Sequence    Length: 122 aa     Download sequence    Send to blast
MSSRGFNIKA RGLCNNNNGG GGTGAKCGRW NPTVEQVKLL TDLFKAGLRT PSTDQIQKIS  60
MELSFYGKIE SKNVFYWFQN HKARERQKCR KISTVKFDHR QDTDLSKPRR DNVRRHQLPA  120
KG
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasAT5G05770
AtGenExpressAT5G05770
Functional Description ? help Back to Top
Source Description
TAIREncodes a WUSCHEL-related homeobox gene family member with 65 amino acids in its homeodomain. Proteins in this family contain a sequence of eight residues (TLPLFPMH) downstream of the homeodomain called the WUS box.
UniProtPotential transcription factor that plays a central role during developmental processes. {ECO:0000250}.
Function -- GeneRIF ? help Back to Top
  1. WOX7 plays an important role in coupling the lateral root development program and sugar status.
    [PMID: 26621542]
  2. the expression switch from WOX11/12 to WOX5/7 is critical for initiation of the root primordium during de novo root organogenesis.
    [PMID: 27784768]
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT5G05770.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT5G05770
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0052370.0AB005237.1 Arabidopsis thaliana genomic DNA, chromosome 5, P1 clone:MJJ3.
GenBankCP0026880.0CP002688.1 Arabidopsis thaliana chromosome 5 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_196196.14e-88WUSCHEL related homeobox 7
SwissprotQ9FFK04e-89WOX7_ARATH; WUSCHEL-related homeobox 7
TrEMBLA0A089VA622e-86A0A089VA62_ARATH; WOX7
STRINGAT5G05770.12e-87(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM40142857
Representative plantOGRP84061116
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. R
    Rapid identification of Arabidopsis insertion mutants by non-radioactive detection of T-DNA tagged genes.
    Plant J., 2002. 32(2): p. 243-53
    [PMID:12383089]
  3. Haecker A, et al.
    Expression dynamics of WOX genes mark cell fate decisions during early embryonic patterning in Arabidopsis thaliana.
    Development, 2004. 131(3): p. 657-68
    [PMID:14711878]
  4. Conte MG,Gaillard S,Droc G,Perin C
    Phylogenomics of plant genomes: a methodology for genome-wide searches for orthologs in plants.
    BMC Genomics, 2008. 9: p. 183
    [PMID:18426584]
  5. Hirakawa Y,Kondo Y,Fukuda H
    TDIF peptide signaling regulates vascular stem cell proliferation via the WOX4 homeobox gene in Arabidopsis.
    Plant Cell, 2010. 22(8): p. 2618-29
    [PMID:20729381]
  6. Zhang X,Zong J,Liu J,Yin J,Zhang D
    Genome-wide analysis of WOX gene family in rice, sorghum, maize, Arabidopsis and poplar.
    J Integr Plant Biol, 2010. 52(11): p. 1016-26
    [PMID:20977659]
  7. Cui H, et al.
    Genome-wide direct target analysis reveals a role for SHORT-ROOT in root vascular patterning through cytokinin homeostasis.
    Plant Physiol., 2011. 157(3): p. 1221-31
    [PMID:21951467]
  8. Lin H,Niu L,Tadege M
    STENOFOLIA acts as a repressor in regulating leaf blade outgrowth.
    Plant Signal Behav, 2013. 8(6): p. e24464
    [PMID:23603965]
  9. Kong D,Hao Y,Cui H
    The WUSCHEL Related Homeobox Protein WOX7 Regulates the Sugar Response of Lateral Root Development in Arabidopsis thaliana.
    Mol Plant, 2016. 9(2): p. 261-270
    [PMID:26621542]
  10. Hu X,Xu L
    Transcription Factors WOX11/12 Directly Activate WOX5/7 to Promote Root Primordia Initiation and Organogenesis.
    Plant Physiol., 2016. 172(4): p. 2363-2373
    [PMID:27784768]