PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | AT4G38000.1 | ||||||||
Common Name | DOF4.7, F20D10.120 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
|
||||||||
Family | Dof | ||||||||
Protein Properties | Length: 246aa MW: 27393.7 Da PI: 9.6805 | ||||||||
Description | DNA binding with one finger 4.7 | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | zf-Dof | 115.4 | 2.3e-36 | 38 | 95 | 3 | 60 |
zf-Dof 3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkk 60 + lkcprCds ntkfCyynnyslsqPr++Ck+CrryWt+GGalrnvP+Gg++r+++k AT4G38000.1 38 QPVLKCPRCDSVNTKFCYYNNYSLSQPRHYCKNCRRYWTRGGALRNVPIGGSTRNKNK 95 56789*************************************************8876 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
ProDom | PD007478 | 8.0E-31 | 35 | 95 | IPR003851 | Zinc finger, Dof-type |
Pfam | PF02701 | 5.8E-32 | 40 | 95 | IPR003851 | Zinc finger, Dof-type |
PROSITE profile | PS50884 | 28.248 | 41 | 95 | IPR003851 | Zinc finger, Dof-type |
PROSITE pattern | PS01361 | 0 | 43 | 79 | IPR003851 | Zinc finger, Dof-type |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0010227 | Biological Process | floral organ abscission | ||||
GO:0045893 | Biological Process | positive regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046872 | Molecular Function | metal ion binding |
Plant Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PO Term | PO Category | PO Description | ||||
PO:0000293 | anatomy | guard cell | ||||
PO:0009005 | anatomy | root | ||||
PO:0009009 | anatomy | plant embryo | ||||
PO:0009010 | anatomy | seed | ||||
PO:0009029 | anatomy | stamen | ||||
PO:0009031 | anatomy | sepal | ||||
PO:0009032 | anatomy | petal | ||||
PO:0009046 | anatomy | flower | ||||
PO:0009047 | anatomy | stem | ||||
PO:0009052 | anatomy | flower pedicel | ||||
PO:0009067 | anatomy | filament | ||||
PO:0025022 | anatomy | collective leaf structure | ||||
PO:0001078 | developmental stage | plant embryo cotyledonary stage | ||||
PO:0001081 | developmental stage | mature plant embryo stage | ||||
PO:0004507 | developmental stage | plant embryo bilateral stage | ||||
PO:0007611 | developmental stage | petal differentiation and expansion stage | ||||
PO:0007616 | developmental stage | flowering stage |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 246 aa Download sequence Send to blast |
MMTSSHQSNT TGFKPRRIKT TAKPPRQINN KEPSPATQPV LKCPRCDSVN TKFCYYNNYS 60 LSQPRHYCKN CRRYWTRGGA LRNVPIGGST RNKNKPCSLQ VISSPPLFSN GTSSASRELV 120 RNHPSTAMMM MSSGGFSGYM FPLDPNFNLA SSSIESLSSF NQDLHQKLQQ QRLVTSMFLQ 180 DSLPVNEKTV MFQNVELIPP STVTTDWVFD RFATGGGATS GNHEDNDDGE GNLGNWFHNA 240 NNNALL |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
At.2738 | 0.0 | bud| silique |
Expression -- Microarray ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | E-value | ||||
Genevisible | 253018_at | 0.0 | ||||
Expression Atlas | AT4G38000 | - | ||||
AtGenExpress | AT4G38000 | - | ||||
ATTED-II | AT4G38000 | - |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Highly expressed at the base of all organs of the flower, especially in the abscission zone (AZ) of petals, stamens and sepals. Expressed at low levels in sepals, filaments, stigmatic papillae, tips of young siliques, and at the base of pedicels and leaf trichomes. {ECO:0000269|PubMed:20466844}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence. Involved in the negative regulation of floral organ abscission by binding to the typical DOF 5'-AAAG-3' sequences in the promoter of ADPG2/PGAZAT, and by down-regulating its expression. ADPG2/PGAZAT is an abscission-related and cell wall hydrolyzing polygalacturonase. May act through the interaction with ZFP2, an abscission-related transcription factor. {ECO:0000269|PubMed:20466844}. |
Function -- GeneRIF ? help Back to Top | ||||||
---|---|---|---|---|---|---|
|
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00478 | DAP | 27203113 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | AT4G38000.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Phenotype -- Mutation ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | |||||
T-DNA Express | AT4G38000 |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AK228613 | 0.0 | AK228613.1 Arabidopsis thaliana mRNA for Dof zinc finger protein - like, complete cds, clone: RAFL15-43-I22. | |||
GenBank | AL035538 | 0.0 | AL035538.1 Arabidopsis thaliana DNA chromosome 4, BAC clone F20D10 (ESSA project). | |||
GenBank | AL161592 | 0.0 | AL161592.2 Arabidopsis thaliana DNA chromosome 4, contig fragment No. 88. | |||
GenBank | BT005767 | 0.0 | BT005767.1 Arabidopsis thaliana clone RAFL15-43-I22 (R20996) putative Dof zinc finger protein (At4g38000) mRNA, complete cds. | |||
GenBank | BT006092 | 0.0 | BT006092.1 Arabidopsis thaliana clone U20996 putative Dof zinc finger protein (At4g38000) mRNA, complete cds. | |||
GenBank | CP002687 | 0.0 | CP002687.1 Arabidopsis thaliana chromosome 4 sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_195513.2 | 0.0 | DNA binding with one finger 4.7 | ||||
Swissprot | Q84K52 | 0.0 | DOF47_ARATH; Dof zinc finger protein DOF4.7 | ||||
TrEMBL | A0A384KID3 | 0.0 | A0A384KID3_ARATH; DOF4.7 | ||||
TrEMBL | Q0WQS4 | 0.0 | Q0WQS4_ARATH; Dof zinc finger protein-like | ||||
STRING | AT4G38000.1 | 0.0 | (Arabidopsis thaliana) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM15286 | 15 | 18 | Representative plant | OGRP38 | 17 | 445 |
Link Out ? help Back to Top | |
---|---|
Phytozome | AT4G38000.1 |
Entrez Gene | 829956 |
iHOP | AT4G38000 |
wikigenes | AT4G38000 |