PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | AT4G36240.1 | ||||||||
Common Name | F23E13.130, GATA7 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
|
||||||||
Family | GATA | ||||||||
Protein Properties | Length: 238aa MW: 26799.2 Da PI: 8.3996 | ||||||||
Description | GATA transcription factor 7 | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | GATA | 58.4 | 9.7e-19 | 166 | 200 | 1 | 35 |
GATA 1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 Cs+Cg+ kTp+WR gp g ktLCnaCG+++++ +l AT4G36240.1 166 CSHCGVQKTPQWRMGPLGAKTLCNACGVRFKSGRL 200 *******************************9986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PIRSF | PIRSF016992 | 1.2E-92 | 1 | 237 | IPR016679 | Transcription factor, GATA, plant |
SuperFamily | SSF57716 | 9.5E-14 | 158 | 222 | No hit | No description |
PROSITE profile | PS50114 | 11.292 | 160 | 196 | IPR000679 | Zinc finger, GATA-type |
SMART | SM00401 | 4.6E-14 | 160 | 214 | IPR000679 | Zinc finger, GATA-type |
Gene3D | G3DSA:3.30.50.10 | 5.9E-14 | 164 | 198 | IPR013088 | Zinc finger, NHR/GATA-type |
Pfam | PF00320 | 1.5E-16 | 166 | 200 | IPR000679 | Zinc finger, GATA-type |
PROSITE pattern | PS00344 | 0 | 166 | 191 | IPR000679 | Zinc finger, GATA-type |
CDD | cd00202 | 2.29E-14 | 166 | 222 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0007623 | Biological Process | circadian rhythm | ||||
GO:0009416 | Biological Process | response to light stimulus | ||||
GO:0030154 | Biological Process | cell differentiation | ||||
GO:0045944 | Biological Process | positive regulation of transcription from RNA polymerase II promoter | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0005667 | Cellular Component | transcription factor complex | ||||
GO:0000977 | Molecular Function | RNA polymerase II regulatory region sequence-specific DNA binding | ||||
GO:0001085 | Molecular Function | RNA polymerase II transcription factor binding | ||||
GO:0001228 | Molecular Function | transcriptional activator activity, RNA polymerase II transcription regulatory region sequence-specific binding | ||||
GO:0003682 | Molecular Function | chromatin binding | ||||
GO:0008270 | Molecular Function | zinc ion binding |
Plant Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PO Term | PO Category | PO Description | ||||
PO:0000293 | anatomy | guard cell |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 238 aa Download sequence Send to blast |
MECVEAFLGD FSVDDLLDLS NADTSLESSS SQRKEDEQER EKFKSFSDQS TRLSPPEDLL 60 SFPGDAPVGD LEDLEWLSNF VEDSFSESYI SSDFPVNPVA SVEVRRQCVP VKPRSKRRRT 120 NGRIWSMESP SPLLSTAVAR RKKRGRQKVD ASYGGVVQQQ QLRRCCSHCG VQKTPQWRMG 180 PLGAKTLCNA CGVRFKSGRL LPEYRPACSP TFTNEIHSNS HRKVLELRLM KVADPARV |
Expression -- Microarray ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | E-value | ||||
GEO | 42567450 | 0.0 | ||||
Expression Atlas | AT4G36240 | - | ||||
AtGenExpress | AT4G36240 | - |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
TAIR | Encodes a member of the GATA factor family of zinc finger transcription factors. | |||||
UniProt | Transcriptional activator that specifically binds 5'-GATA-3' or 5'-GAT-3' motifs within gene promoters. May be involved in the regulation of some light-responsive genes (By similarity). {ECO:0000250}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | AT4G36240.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Phenotype -- Mutation ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | |||||
T-DNA Express | AT4G36240 |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AY072434 | 0.0 | AY072434.1 Arabidopsis thaliana putative protein (At4g36240) mRNA, complete cds. | |||
GenBank | AY114720 | 0.0 | AY114720.1 Arabidopsis thaliana putative protein (At4g36240) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_195347.1 | 1e-176 | GATA transcription factor 7 | ||||
Swissprot | O65515 | 1e-177 | GATA7_ARATH; GATA transcription factor 7 | ||||
TrEMBL | A0A178UWZ0 | 1e-174 | A0A178UWZ0_ARATH; GATA transcription factor | ||||
STRING | AT4G36240.1 | 1e-175 | (Arabidopsis thaliana) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM14654 | 17 | 20 | Representative plant | OGRP68 | 17 | 287 |
Link Out ? help Back to Top | |
---|---|
Phytozome | AT4G36240.1 |
Entrez Gene | 829781 |
iHOP | AT4G36240 |
wikigenes | AT4G36240 |