PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | AT4G20970.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
|
||||||||
Family | bHLH | ||||||||
Protein Properties | Length: 190aa MW: 21576.6 Da PI: 7.3682 | ||||||||
Description | bHLH family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | HLH | 35.6 | 1.7e-11 | 17 | 64 | 6 | 55 |
HHHHHHHHHHHHHHHHHHHCTSCCC...TTS-STCHHHHHHHHHHHHHHH CS HLH 6 nerErrRRdriNsafeeLrellPkaskapskKlsKaeiLekAveYIksLq 55 + +E++RR +++s ++eL +llP+ + + l+ + L +A +YIk+Lq AT4G20970.1 17 KTVEKNRRMQMKSLYSELISLLPHH--SSTEPLTLPDQLDEAANYIKKLQ 64 789*********************6..16666*****************9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50888 | 11.585 | 11 | 63 | IPR011598 | Myc-type, basic helix-loop-helix (bHLH) domain |
CDD | cd00083 | 1.05E-5 | 11 | 68 | No hit | No description |
SuperFamily | SSF47459 | 3.73E-10 | 16 | 79 | IPR011598 | Myc-type, basic helix-loop-helix (bHLH) domain |
Gene3D | G3DSA:4.10.280.10 | 7.5E-9 | 16 | 78 | IPR011598 | Myc-type, basic helix-loop-helix (bHLH) domain |
Pfam | PF00010 | 9.4E-7 | 17 | 64 | IPR011598 | Myc-type, basic helix-loop-helix (bHLH) domain |
SMART | SM00353 | 0.0023 | 17 | 69 | IPR011598 | Myc-type, basic helix-loop-helix (bHLH) domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006357 | Biological Process | regulation of transcription from RNA polymerase II promoter | ||||
GO:0050832 | Biological Process | defense response to fungus | ||||
GO:0090575 | Cellular Component | RNA polymerase II transcription factor complex | ||||
GO:0000977 | Molecular Function | RNA polymerase II regulatory region sequence-specific DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Plant Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PO Term | PO Category | PO Description | ||||
PO:0000293 | anatomy | guard cell |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 190 aa Download sequence Send to blast |
MEPSHSNTGQ SRSVDRKTVE KNRRMQMKSL YSELISLLPH HSSTEPLTLP DQLDEAANYI 60 KKLQVNVEKK RERKRNLVAT TTLEKLNSVG SSSVSSSVDV SVPRKLPKIE IQETGSIFHI 120 FLVTSLEHKF MFCEIIRVLT EELGAEITHA GYSIVDDAVF HTLHCKVEEH DYGARSQIPE 180 RLEKIVNSVH |
Expression -- Microarray ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | E-value | ||||
GEO | 22328837 | 0.0 | ||||
Expression Atlas | AT4G20970 | - | ||||
AtGenExpress | AT4G20970 | - |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | AT4G20970.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Phenotype -- Mutation ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | |||||
T-DNA Express | AT4G20970 |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AB493686 | 0.0 | AB493686.1 Arabidopsis thaliana At4g20970 mRNA for hypothetical protein, partial cds, clone: RAAt4g20970. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_193829.2 | 1e-138 | basic helix-loop-helix (bHLH) DNA-binding superfamily protein | ||||
Swissprot | F4JIJ7 | 1e-139 | BH162_ARATH; Transcription factor bHLH162 | ||||
TrEMBL | A0A178UYG1 | 1e-136 | A0A178UYG1_ARATH; Uncharacterized protein | ||||
STRING | AT4G20970.1 | 1e-137 | (Arabidopsis thaliana) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM1278 | 25 | 92 | Representative plant | OGRP1345 | 11 | 47 |
Link Out ? help Back to Top | |
---|---|
Phytozome | AT4G20970.1 |
Entrez Gene | 827844 |
iHOP | AT4G20970 |
wikigenes | AT4G20970 |
Publications ? help Back to Top | |||
---|---|---|---|
|