PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

AT4G18170.1

Common Name

ATWRKY28, F15J5.1, T9A21.10, WRKY28

Organism

Arabidopsis thaliana

Taxonomic ID

3702

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis

Family

WRKY

Protein Properties

Length: 318aa MW: 35563 Da PI: 7.5968

Description

WRKY DNA-binding protein 28

Gene Model

Gene Model ID	Type	Source	Coding Sequence
AT4G18170.1	genome	TAIR	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	WRKY	108.4	3.5e-34	172	229	2	59
--SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 +Dgy+WrKYGqK vk+s++prsYYrCt+++C+vkk+vers +dp+vv++tYeg+Hnh+ AT4G18170.1 172 EDGYRWRKYGQKAVKNSPYPRSYYRCTTQKCNVKKRVERSFQDPTVVITTYEGQHNHP 229 8********************************************************7 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PIRSF	PIRSF038130	2.2E-117	1	318	IPR017396	PWRKY transcription factor, group IIc
Gene3D	G3DSA:2.20.25.80	1.1E-35	156	231	IPR003657	WRKY domain
SuperFamily	SSF118290	1.01E-29	163	231	IPR003657	WRKY domain
PROSITE profile	PS50811	32.856	166	231	IPR003657	WRKY domain
SMART	SM00774	8.0E-40	171	230	IPR003657	WRKY domain
Pfam	PF03106	2.0E-26	172	229	IPR003657	WRKY domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Plant Ontology ? help Back to Top
PO Term	PO Category	PO Description
PO:0000293	anatomy	guard cell
PO:0009029	anatomy	stamen
PO:0009031	anatomy	sepal
PO:0009047	anatomy	stem
PO:0007616	developmental stage	flowering stage

Sequence ? help Back to Top
Protein Sequence Length: 318 aa Download sequence Send to blast
MSNETRDLYN YQYPSSFSLH EMMNLPTSNP SSYGNLPSQN GFNPSTYSFT DCLQSSPAAY 60 ESLLQKTFGL SPSSSEVFNS SIDQEPNRDV TNDVINGGAC NETETRVSPS NSSSSEADHP 120 GEDSGKSRRK RELVGEEDQI SKKVGKTKKT EVKKQREPRV SFMTKSEVDH LEDGYRWRKY 180 GQKAVKNSPY PRSYYRCTTQ KCNVKKRVER SFQDPTVVIT TYEGQHNHPI PTNLRGSSAA 240 AAMFSADLMT PRSFAHDMFR TAAYTNGGSV AAALDYGYGQ SGYGSVNSNP SSHQVYHQGG 300 EYELLREIFP SIFFKQEP

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1wj2_A	2e-29	162	231	8	77	Probable WRKY transcription factor 4
2lex_A	2e-29	162	231	8	77	Probable WRKY transcription factor 4
Search in ModeBase

Expression -- Microarray ? help Back to Top
Source	ID	E-value
Genevisible	254652_at	1e-174
Expression Atlas	AT4G18170	-
AtGenExpress	AT4G18170	-
ATTED-II	AT4G18170	-

Functional Description ? help Back to Top
Source	Description
TAIR	member of WRKY Transcription Factor; Group II-c
UniProt	Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}.

Function -- GeneRIF ? help Back to Top
WRKY28 specifically binds to the ICS1 promoter in vivo, most probably to one or both binding sites at position -460 and -445 upstream of the transcription start site. [PMID: 21595875] A few genes having either WRKY or bHLH cis elements in their promoter regions showed higher transcript levels than wild type. [PMID: 22948308] Transgenic lines overexpressing AtWRKY28 and AtWRKY75 showed enhanced resistance to oxalic acid and S. sclerotiorum, demonstrating that both AtWRKY28 and AtWRKY75 are novel positive regulators in Arabidopsis defense responses. [PMID: 23749099] These findings show how somatic cells in ovule primordia cooperatively use chromatin remodeling to restrict germ-line cell specification to a single cell. [PMID: 29288215]

Binding Motif ? help Back to Top
Motif ID	Method	Source	Motif file
MP00440	DAP	27203113	Download

Cis-element ? help Back to Top
Source	Link
PlantRegMap	AT4G18170.1

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	Retrieve

Interaction ? help Back to Top
Source	Intact With
BioGRID	AT5G51910, AT5G60970, AT1G53230, AT1G58100

Phenotype -- Mutation ? help Back to Top
Source	ID
T-DNA Express	AT4G18170

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AF442393	0.0	AF442393.1 Arabidopsis thaliana WRKY transcription factor 28 (WRKY28) mRNA, complete cds.
GenBank	AY070761	0.0	AY070761.1 Arabidopsis thaliana AT4g18170/T9A21_10 mRNA, complete cds.
GenBank	AY116943	0.0	AY116943.1 Arabidopsis thaliana AT4g18170/T9A21_10 mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	NP_193551.1	0.0	WRKY DNA-binding protein 28
Swissprot	Q8VWJ2	0.0	WRK28_ARATH; WRKY transcription factor 28
TrEMBL	A0A178V3M3	0.0	A0A178V3M3_ARATH; WRKY transcription factor
STRING	AT4G18170.1	0.0	(Arabidopsis thaliana)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM1524	26	93
Representative plant	OGRP14	17	875

Link Out ? help Back to Top
Phytozome	AT4G18170.1
Entrez Gene	827542
iHOP	AT4G18170
wikigenes	AT4G18170

Publications ? help Back to Top
Eulgem T,Rushton PJ,Robatzek S,Somssich IE The WRKY superfamily of plant transcription factors. Trends Plant Sci., 2000. 5(5): p. 199-206 [PMID:10785665] Riechmann JL, et al. Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes. Science, 2000. 290(5499): p. 2105-10 [PMID:11118137] Yamada K, et al. Empirical analysis of transcriptional activity in the Arabidopsis genome. Science, 2003. 302(5646): p. 842-6 [PMID:14593172] Navarro L, et al. The transcriptional innate immune response to flg22. Interplay and overlap with Avr gene-dependent defense responses and bacterial pathogenesis. Plant Physiol., 2004. 135(2): p. 1113-28 [PMID:15181213] Sottosanto JB,Gelli A,Blumwald E DNA array analyses of Arabidopsis thaliana lacking a vacuolar Na+/H+ antiporter: impact of AtNHX1 on gene expression. Plant J., 2004. 40(5): p. 752-71 [PMID:15546358] Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Ma S,Gong Q,Bohnert HJ Dissecting salt stress pathways. J. Exp. Bot., 2006. 57(5): p. 1097-107 [PMID:16510518] Truman W,de Zabala MT,Grant M Type III effectors orchestrate a complex interplay between transcriptional networks to modify basal defence responses during pathogenesis and resistance. Plant J., 2006. 46(1): p. 14-33 [PMID:16553893] Qutob D, et al. Phytotoxicity and innate immune responses induced by Nep1-like proteins. Plant Cell, 2006. 18(12): p. 3721-44 [PMID:17194768] van Verk MC,Bol JF,Linthorst HJ WRKY transcription factors involved in activation of SA biosynthesis genes. BMC Plant Biol., 2011. 11: p. 89 [PMID:21595875] Babitha KC, et al. Co-expression of AtbHLH17 and AtWRKY28 confers resistance to abiotic stress in Arabidopsis. Transgenic Res., 2013. 22(2): p. 327-41 [PMID:22948308] Truman W,Glazebrook J Co-expression analysis identifies putative targets for CBP60g and SARD1 regulation. BMC Plant Biol., 2012. 12: p. 216 [PMID:23153277] Gao X,He P Nuclear dynamics of Arabidopsis calcium-dependent protein kinases in effector-triggered immunity. Plant Signal Behav, 2013. 8(4): p. e23868 [PMID:23425856] Chen X, et al. Overexpression of AtWRKY28 and AtWRKY75 in Arabidopsis enhances resistance to oxalic acid and Sclerotinia sclerotiorum. Plant Cell Rep., 2013. 32(10): p. 1589-99 [PMID:23749099] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Lumba S, et al. A mesoscale abscisic acid hormone interactome reveals a dynamic signaling landscape in Arabidopsis. Dev. Cell, 2014. 29(3): p. 360-72 [PMID:24823379] Kim SH, et al. Characterization of a Novel DWD protein that participates in heat stress response in Arabidopsis. Mol. Cells, 2014. 37(11): p. 833-40 [PMID:25358503] Wang X, et al. TCP transcription factors are critical for the coordinated regulation of isochorismate synthase 1 expression in Arabidopsis thaliana. Plant J., 2015. 82(1): p. 151-62 [PMID:25702611] Zhao L, et al. KLU suppresses megasporocyte cell fate through SWR1-mediated activation of WRKY28 expression in Arabidopsis. Proc. Natl. Acad. Sci. U.S.A., 2018. 115(3): p. E526-E535 [PMID:29288215]