PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | AT3G61850.3 | ||||||||
Common Name | BBFA, DAG1, DOF3.7, F21F14.20 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
|
||||||||
Family | Dof | ||||||||
Protein Properties | Length: 284aa MW: 31542.9 Da PI: 9.8563 | ||||||||
Description | Dof family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | zf-Dof | 123.4 | 7.6e-39 | 58 | 118 | 2 | 62 |
zf-Dof 2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 ++++++cprC+stntkfCyynnysl+qPryfCk+CrryWt+GG+lrnvPvGg++rknk+ss AT3G61850.3 58 PQEKVNCPRCNSTNTKFCYYNNYSLTQPRYFCKGCRRYWTEGGSLRNVPVGGSSRKNKRSS 118 6899******************************************************986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
ProDom | PD007478 | 4.0E-30 | 57 | 116 | IPR003851 | Zinc finger, Dof-type |
Pfam | PF02701 | 6.1E-33 | 60 | 116 | IPR003851 | Zinc finger, Dof-type |
PROSITE profile | PS50884 | 28.705 | 62 | 116 | IPR003851 | Zinc finger, Dof-type |
PROSITE pattern | PS01361 | 0 | 64 | 100 | IPR003851 | Zinc finger, Dof-type |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0009639 | Biological Process | response to red or far red light | ||||
GO:0009845 | Biological Process | seed germination | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0044212 | Molecular Function | transcription regulatory region DNA binding | ||||
GO:0046872 | Molecular Function | metal ion binding |
Plant Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PO Term | PO Category | PO Description | ||||
PO:0000037 | anatomy | shoot apex | ||||
PO:0000230 | anatomy | inflorescence meristem | ||||
PO:0000293 | anatomy | guard cell | ||||
PO:0003015 | anatomy | primary root differentiation zone | ||||
PO:0005417 | anatomy | phloem | ||||
PO:0005679 | anatomy | epidermis | ||||
PO:0008019 | anatomy | leaf lamina base | ||||
PO:0009005 | anatomy | root | ||||
PO:0009006 | anatomy | shoot system | ||||
PO:0009009 | anatomy | plant embryo | ||||
PO:0009010 | anatomy | seed | ||||
PO:0009025 | anatomy | vascular leaf | ||||
PO:0009029 | anatomy | stamen | ||||
PO:0009030 | anatomy | carpel | ||||
PO:0009031 | anatomy | sepal | ||||
PO:0009032 | anatomy | petal | ||||
PO:0009046 | anatomy | flower | ||||
PO:0009047 | anatomy | stem | ||||
PO:0020100 | anatomy | hypocotyl | ||||
PO:0020124 | anatomy | root stele | ||||
PO:0020137 | anatomy | leaf apex | ||||
PO:0025022 | anatomy | collective leaf structure | ||||
PO:0025257 | anatomy | primary root elongation zone | ||||
PO:0025281 | anatomy | pollen | ||||
PO:0001054 | developmental stage | vascular leaf senescent stage | ||||
PO:0001078 | developmental stage | plant embryo cotyledonary stage | ||||
PO:0001081 | developmental stage | mature plant embryo stage | ||||
PO:0001185 | developmental stage | plant embryo globular stage | ||||
PO:0004507 | developmental stage | plant embryo bilateral stage | ||||
PO:0007064 | developmental stage | LP.12 twelve leaves visible stage | ||||
PO:0007095 | developmental stage | LP.08 eight leaves visible stage | ||||
PO:0007098 | developmental stage | LP.02 two leaves visible stage | ||||
PO:0007103 | developmental stage | LP.10 ten leaves visible stage | ||||
PO:0007115 | developmental stage | LP.04 four leaves visible stage | ||||
PO:0007123 | developmental stage | LP.06 six leaves visible stage | ||||
PO:0007611 | developmental stage | petal differentiation and expansion stage | ||||
PO:0007616 | developmental stage | flowering stage |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 284 aa Download sequence Send to blast |
MINVKPMEQM ISSTNNNTPQ QQPTFIATNT RPNATASNGG SGGNTNNTAT METRKARPQE 60 KVNCPRCNST NTKFCYYNNY SLTQPRYFCK GCRRYWTEGG SLRNVPVGGS SRKNKRSSTP 120 LASPSNPKLP DLNPPILFSS QIPNKSNKDL NLLSFPVMQD HHHHALELLR SNGVSSRGMN 180 TFLPGQMMDS NSVLYSSLGF PTMPDYKQSN NNLSFSIDHH QGIGHNTINS NQRAQDNNDD 240 MNGASRVLFP FSDMKELSST TQEKSHGNNT YWNGMFSNTG GSSW |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
At.989 | 0.0 | root |
Expression -- Microarray ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | E-value | ||||
Genevisible | 251290_at | 0.0 | ||||
Expression Atlas | AT3G61850 | - | ||||
AtGenExpress | AT3G61850 | - | ||||
ATTED-II | AT3G61850 | - |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: Turned off in siliques when they reached full maturation. Not expressed in developing or mature embryos. | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in the phloem of the mother plant, including in roots, stem, leaves and flowers, but not present in the seed and embryo. In maturing siliques, found all through the funiculus connecting the placenta to the ovule, but not in the ovule. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
TAIR | Zinc finger transcription factor of the Dof family involved in the control of seed germination. | |||||
UniProt | Transcription factor specifically involved in the maternal control of seed germination. Regulates transcription by binding to a 5'-AA[AG]G-3' consensus core sequence. May ensure the inactivity of a component that would be activated to trigger germination as a consequence of red light perception. |
Function -- GeneRIF ? help Back to Top | ||||||
---|---|---|---|---|---|---|
|
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | AT3G61850.3 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Regulation -- ATRM (Manually Curated Target Genes) ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Target Gene (A: Activate/R: Repress) | |||||
ATRM | AT1G15550(R) |
Regulation -- Hormone ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hormone | |||||
AHD | Gibberellin |
Phenotype -- Mutation ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | |||||
T-DNA Express | AT3G61850 |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AK117352 | 0.0 | AK117352.1 Arabidopsis thaliana At3g61850 mRNA for putative transcription factor BBFa, complete cds, clone: RAFL16-91-P20. | |||
GenBank | BT033127 | 0.0 | BT033127.1 Arabidopsis thaliana unknown protein (At3g61850) mRNA, complete cds. | |||
GenBank | X97941 | 0.0 | X97941.2 A.thaliana mRNA for zinc finger protein DAG1 (BBFa). |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_191744.1 | 0.0 | Dof-type zinc finger DNA-binding family protein | ||||
Swissprot | Q43385 | 0.0 | DOF37_ARATH; Dof zinc finger protein DOF3.7 | ||||
TrEMBL | B4F7P4 | 0.0 | B4F7P4_ARATH; At3g61850 | ||||
STRING | AT3G61850.4 | 0.0 | (Arabidopsis thaliana) |
Link Out ? help Back to Top | |
---|---|
Phytozome | AT3G61850.3 |
Entrez Gene | 825358 |
iHOP | AT3G61850 |
wikigenes | AT3G61850 |