PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | AT3G59470.2 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
|
||||||||
Family | FAR1 | ||||||||
Protein Properties | Length: 251aa MW: 28864.4 Da PI: 6.3775 | ||||||||
Description | FAR1 family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | FAR1 | 95.1 | 8.4e-30 | 85 | 172 | 2 | 91 |
FAR1 2 fYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHelap 91 fYn+YA++vGF +r+sk ++s+++g+ + r++vC+keg+r ++k++ k r+raetr+gCka++ ++ke++gkw++tk+++eHnH+l+p AT3G59470.2 85 FYNAYATKVGFVIRVSKLSRSRHDGSPIGRQLVCNKEGYRLPSKRD--KVIRQRAETRVGCKAMILIRKENSGKWVITKFVKEHNHSLMP 172 9******************************************999..999************************************986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF03101 | 1.3E-27 | 85 | 172 | IPR004330 | FAR1 DNA binding domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0009585 | Biological Process | red, far-red light phototransduction | ||||
GO:0010018 | Biological Process | far-red light signaling pathway | ||||
GO:0042753 | Biological Process | positive regulation of circadian rhythm | ||||
GO:0045893 | Biological Process | positive regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding |
Plant Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PO Term | PO Category | PO Description | ||||
PO:0000013 | anatomy | cauline leaf | ||||
PO:0000037 | anatomy | shoot apex | ||||
PO:0000084 | anatomy | plant sperm cell | ||||
PO:0000230 | anatomy | inflorescence meristem | ||||
PO:0000293 | anatomy | guard cell | ||||
PO:0008019 | anatomy | leaf lamina base | ||||
PO:0009005 | anatomy | root | ||||
PO:0009006 | anatomy | shoot system | ||||
PO:0009009 | anatomy | plant embryo | ||||
PO:0009010 | anatomy | seed | ||||
PO:0009025 | anatomy | vascular leaf | ||||
PO:0009029 | anatomy | stamen | ||||
PO:0009030 | anatomy | carpel | ||||
PO:0009031 | anatomy | sepal | ||||
PO:0009032 | anatomy | petal | ||||
PO:0009046 | anatomy | flower | ||||
PO:0009047 | anatomy | stem | ||||
PO:0009052 | anatomy | flower pedicel | ||||
PO:0020030 | anatomy | cotyledon | ||||
PO:0020038 | anatomy | petiole | ||||
PO:0020100 | anatomy | hypocotyl | ||||
PO:0020137 | anatomy | leaf apex | ||||
PO:0025022 | anatomy | collective leaf structure | ||||
PO:0025195 | anatomy | pollen tube cell | ||||
PO:0025281 | anatomy | pollen | ||||
PO:0001054 | developmental stage | vascular leaf senescent stage | ||||
PO:0001078 | developmental stage | plant embryo cotyledonary stage | ||||
PO:0001081 | developmental stage | mature plant embryo stage | ||||
PO:0001185 | developmental stage | plant embryo globular stage | ||||
PO:0004507 | developmental stage | plant embryo bilateral stage | ||||
PO:0007064 | developmental stage | LP.12 twelve leaves visible stage | ||||
PO:0007095 | developmental stage | LP.08 eight leaves visible stage | ||||
PO:0007098 | developmental stage | LP.02 two leaves visible stage | ||||
PO:0007103 | developmental stage | LP.10 ten leaves visible stage | ||||
PO:0007115 | developmental stage | LP.04 four leaves visible stage | ||||
PO:0007123 | developmental stage | LP.06 six leaves visible stage | ||||
PO:0007611 | developmental stage | petal differentiation and expansion stage | ||||
PO:0007616 | developmental stage | flowering stage |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 251 aa Download sequence Send to blast |
MMMGIPVELE VTTVENHNEM GESSGQAMIE QDDDNHNELG ENSGEQDEKV DLDSIPLAVA 60 DMTEAQGDEP YVGQEFESEA AAHGFYNAYA TKVGFVIRVS KLSRSRHDGS PIGRQLVCNK 120 EGYRLPSKRD KVIRQRAETR VGCKAMILIR KENSGKWVIT KFVKEHNHSL MPGRVRRGCI 180 YDQYPNEHDK IQELMQQLAA EKKRAATYKR HLEMLFEQIE QHNESLSKRI QHIVDNVRNL 240 EQRDHQQNHQ V |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
At.26657 | 0.0 | inflorescence |
Expression -- Microarray ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | E-value | ||||
Genevisible | 251467_at | 0.0 | ||||
Expression Atlas | AT3G59470 | - | ||||
AtGenExpress | AT3G59470 | - | ||||
ATTED-II | AT3G59470 | - |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | AT3G59470.2 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Interaction ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Intact With | |||||
BioGRID | AT1G23420 |
Phenotype -- Mutation ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | |||||
T-DNA Express | AT3G59470 |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AY058089 | 0.0 | AY058089.1 Arabidopsis thaliana AT3g59470/T16L24_20 mRNA, complete cds. | |||
GenBank | AY143081 | 0.0 | AY143081.1 Arabidopsis thaliana At3g59470/T16L24_20 mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_001319800.1 | 0.0 | Far-red impaired responsive (FAR1) family protein | ||||
Refseq | NP_001326133.1 | 0.0 | Far-red impaired responsive (FAR1) family protein | ||||
Refseq | NP_567085.1 | 0.0 | Far-red impaired responsive (FAR1) family protein | ||||
TrEMBL | A0A384KKS1 | 0.0 | A0A384KKS1_ARATH; Uncharacterized protein | ||||
TrEMBL | F4J8B6 | 0.0 | F4J8B6_ARATH; Far-red impaired responsive (FAR1) family protein | ||||
TrEMBL | Q93Z68 | 0.0 | Q93Z68_ARATH; AT3g59470/T16L24_20 | ||||
STRING | AT3G59470.1 | 0.0 | (Arabidopsis thaliana) |
Link Out ? help Back to Top | |
---|---|
Phytozome | AT3G59470.2 |
Entrez Gene | 825116 |
iHOP | AT3G59470 |
wikigenes | AT3G59470 |
Publications ? help Back to Top | |||
---|---|---|---|
|