PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | AT3G47600.1 | ||||||||
Common Name | ATMYB94, ATMYBCP70, F1P2.150, MYB94 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 333aa MW: 37143.5 Da PI: 6.7861 | ||||||||
Description | myb domain protein 94 | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 58.7 | 1.3e-18 | 14 | 61 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+WT+eEd +lv +++++G+g+W++++ + g++R+ k+c++rw +yl AT3G47600.1 14 KGPWTPEEDIILVSYIQEHGPGNWRSVPTHTGLRRCSKSCRLRWTNYL 61 79********************************************97 PP | |||||||
2 | Myb_DNA-binding | 48.5 | 2.1e-15 | 67 | 112 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg++T+ E++ ++++ ++lG++ W++Ia++++ Rt++++k++w+++l AT3G47600.1 67 RGNFTEHEEKMILHLQALLGNR-WAAIASYLP-ERTDNDIKNYWNTHL 112 89********************.*********.************996 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.60 | 4.6E-25 | 5 | 64 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 26.71 | 9 | 65 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 6.11E-31 | 11 | 108 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 2.7E-15 | 13 | 63 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 3.4E-17 | 14 | 61 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 5.26E-12 | 16 | 61 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 1.6E-24 | 65 | 117 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 19.318 | 66 | 116 | IPR017930 | Myb domain |
SMART | SM00717 | 6.8E-16 | 66 | 114 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 5.2E-14 | 67 | 112 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 1.48E-11 | 69 | 112 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006357 | Biological Process | regulation of transcription from RNA polymerase II promoter | ||||
GO:0009651 | Biological Process | response to salt stress | ||||
GO:0009723 | Biological Process | response to ethylene | ||||
GO:0009733 | Biological Process | response to auxin | ||||
GO:0009737 | Biological Process | response to abscisic acid | ||||
GO:0009751 | Biological Process | response to salicylic acid | ||||
GO:0009753 | Biological Process | response to jasmonic acid | ||||
GO:0030154 | Biological Process | cell differentiation | ||||
GO:0046686 | Biological Process | response to cadmium ion | ||||
GO:0080167 | Biological Process | response to karrikin | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0000981 | Molecular Function | RNA polymerase II transcription factor activity, sequence-specific DNA binding | ||||
GO:0001135 | Molecular Function | transcription factor activity, RNA polymerase II transcription factor recruiting | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0044212 | Molecular Function | transcription regulatory region DNA binding |
Plant Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PO Term | PO Category | PO Description | ||||
PO:0000013 | anatomy | cauline leaf | ||||
PO:0000037 | anatomy | shoot apex | ||||
PO:0000293 | anatomy | guard cell | ||||
PO:0008019 | anatomy | leaf lamina base | ||||
PO:0009005 | anatomy | root | ||||
PO:0009006 | anatomy | shoot system | ||||
PO:0009009 | anatomy | plant embryo | ||||
PO:0009010 | anatomy | seed | ||||
PO:0009025 | anatomy | vascular leaf | ||||
PO:0009029 | anatomy | stamen | ||||
PO:0009030 | anatomy | carpel | ||||
PO:0009031 | anatomy | sepal | ||||
PO:0009032 | anatomy | petal | ||||
PO:0009046 | anatomy | flower | ||||
PO:0009047 | anatomy | stem | ||||
PO:0009052 | anatomy | flower pedicel | ||||
PO:0020030 | anatomy | cotyledon | ||||
PO:0020038 | anatomy | petiole | ||||
PO:0020100 | anatomy | hypocotyl | ||||
PO:0020137 | anatomy | leaf apex | ||||
PO:0025022 | anatomy | collective leaf structure | ||||
PO:0025281 | anatomy | pollen | ||||
PO:0001054 | developmental stage | vascular leaf senescent stage | ||||
PO:0001078 | developmental stage | plant embryo cotyledonary stage | ||||
PO:0001081 | developmental stage | mature plant embryo stage | ||||
PO:0001185 | developmental stage | plant embryo globular stage | ||||
PO:0004507 | developmental stage | plant embryo bilateral stage | ||||
PO:0007064 | developmental stage | LP.12 twelve leaves visible stage | ||||
PO:0007095 | developmental stage | LP.08 eight leaves visible stage | ||||
PO:0007098 | developmental stage | LP.02 two leaves visible stage | ||||
PO:0007103 | developmental stage | LP.10 ten leaves visible stage | ||||
PO:0007115 | developmental stage | LP.04 four leaves visible stage | ||||
PO:0007123 | developmental stage | LP.06 six leaves visible stage | ||||
PO:0007611 | developmental stage | petal differentiation and expansion stage | ||||
PO:0007616 | developmental stage | flowering stage |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 333 aa Download sequence Send to blast |
MGRPPCCDKI GVKKGPWTPE EDIILVSYIQ EHGPGNWRSV PTHTGLRRCS KSCRLRWTNY 60 LRPGIKRGNF TEHEEKMILH LQALLGNRWA AIASYLPERT DNDIKNYWNT HLKKKLKKMN 120 DSCDSTINNG LDNKDFSISN KNTTSHQSSN SSKGQWERRL QTDINMAKQA LCDALSIDKP 180 QNPTNFSIPD LGYGPSSSSS STTTTTTTTR NTNPYPSGVY ASSAENIARL LQNFMKDTPK 240 TSVPLPVAAT EMAITTAASS PSTTEGDGEG IDHSLFSFNS IDEAEEKPKL IDHDINGLIT 300 QGSLSLFEKW LFDEQSHDMI INNMSLEGQE VLF |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1gv2_A | 1e-26 | 14 | 116 | 4 | 105 | MYB PROTO-ONCOGENE PROTEIN |
1h8a_C | 1e-26 | 14 | 116 | 27 | 128 | MYB TRANSFORMING PROTEIN |
1mse_C | 8e-27 | 14 | 116 | 4 | 105 | C-Myb DNA-Binding Domain |
1msf_C | 8e-27 | 14 | 116 | 4 | 105 | C-Myb DNA-Binding Domain |
Search in ModeBase |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
At.21591 | 0.0 | flower| seed| silique |
Expression -- Microarray ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | E-value | ||||
GEO | 3941527 | 0.0 | ||||
Genevisible | 252408_at | 0.0 | ||||
Expression Atlas | AT3G47600 | - | ||||
AtGenExpress | AT3G47600 | - | ||||
ATTED-II | AT3G47600 | - |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in germinating seeds, rosette and cauline leaves, flower buds, open flowers, stems and developing siliques. {ECO:0000269|PubMed:25305760}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
TAIR | Encodes a putative transcription factor (MYB94). | |||||
UniProt | Transcription activator involved in the activation of cuticular wax biosynthesis under drought stress. Binds directly to the promoters of genes involved in cuticular wax biosynthesis. Transactivates WSD1, KCS2/DAISY, CER1, CER2, FAR3 and ECR genes (PubMed:25305760, PubMed:27577115). Functions together with MYB96 in the activation of cuticular wax biosynthesis (PubMed:27577115). {ECO:0000269|PubMed:25305760, ECO:0000269|PubMed:27577115}. |
Function -- GeneRIF ? help Back to Top | ||||||
---|---|---|---|---|---|---|
|
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00395 | DAP | 27203113 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | AT3G47600.1 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by salt stress, osmotic shock and abscisic acid (ABA). {ECO:0000269|PubMed:25305760}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Regulation -- Hormone ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hormone | |||||
AHD | abscisic acid, auxin, ethylene, jasmonic acid, salicylic acid |
Phenotype -- Mutation ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | |||||
T-DNA Express | AT3G47600 |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AY519595 | 0.0 | AY519595.1 Arabidopsis thaliana MYB transcription factor (At3g47600) mRNA, complete cds. | |||
GenBank | BT002802 | 0.0 | BT002802.1 Arabidopsis thaliana clone RAFL15-01-L01 (R20190) putative transcription factor MYB94 (At3g47600) mRNA, complete cds. | |||
GenBank | BT004361 | 0.0 | BT004361.1 Arabidopsis thaliana clone U20190 putative transcription factor MYB94 (At3g47600) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_190344.1 | 0.0 | myb domain protein 94 | ||||
Swissprot | Q9SN78 | 0.0 | MYB94_ARATH; Transcription factor MYB94 | ||||
TrEMBL | A0A178VGF5 | 0.0 | A0A178VGF5_ARATH; MYB94 | ||||
STRING | AT3G47600.1 | 0.0 | (Arabidopsis thaliana) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM4 | 28 | 2646 | Representative plant | OGRP5 | 17 | 1784 |
Link Out ? help Back to Top | |
---|---|
Phytozome | AT3G47600.1 |
Entrez Gene | 823914 |
iHOP | AT3G47600 |
wikigenes | AT3G47600 |