PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | AT3G45610.1 | ||||||||
Common Name | DOF3.2, DOF6, F9K21.190 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
|
||||||||
Family | Dof | ||||||||
Protein Properties | Length: 245aa MW: 26958 Da PI: 9.1147 | ||||||||
Description | Dof family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | zf-Dof | 120.8 | 5e-38 | 36 | 97 | 2 | 63 |
zf-Dof 2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkksss 63 +e++l+cprCdstntkfCyynnyslsqPryfCk+CrryWtkGG lrn+P+Gg+ rk+k+sss AT3G45610.1 36 PEQSLRCPRCDSTNTKFCYYNNYSLSQPRYFCKSCRRYWTKGGILRNIPIGGAYRKHKRSSS 97 67899*****************************************************9875 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
ProDom | PD007478 | 5.0E-30 | 36 | 94 | IPR003851 | Zinc finger, Dof-type |
Pfam | PF02701 | 6.4E-33 | 38 | 94 | IPR003851 | Zinc finger, Dof-type |
PROSITE profile | PS50884 | 28.407 | 40 | 94 | IPR003851 | Zinc finger, Dof-type |
PROSITE pattern | PS01361 | 0 | 42 | 78 | IPR003851 | Zinc finger, Dof-type |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0044212 | Molecular Function | transcription regulatory region DNA binding | ||||
GO:0046872 | Molecular Function | metal ion binding |
Plant Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PO Term | PO Category | PO Description | ||||
PO:0000293 | anatomy | guard cell | ||||
PO:0009009 | anatomy | plant embryo | ||||
PO:0009010 | anatomy | seed | ||||
PO:0009031 | anatomy | sepal | ||||
PO:0009032 | anatomy | petal | ||||
PO:0009046 | anatomy | flower | ||||
PO:0009052 | anatomy | flower pedicel | ||||
PO:0025022 | anatomy | collective leaf structure | ||||
PO:0001081 | developmental stage | mature plant embryo stage | ||||
PO:0001185 | developmental stage | plant embryo globular stage | ||||
PO:0007611 | developmental stage | petal differentiation and expansion stage | ||||
PO:0007616 | developmental stage | flowering stage |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 245 aa Download sequence Send to blast |
MDYSSMHQNV MGVSSCSTQD YQNQKKPLSA TRPAPPEQSL RCPRCDSTNT KFCYYNNYSL 60 SQPRYFCKSC RRYWTKGGIL RNIPIGGAYR KHKRSSSATK SLRTTPEPTM THDGKSFPTA 120 SFGYNNNNIS NEQMELGLAY ALLNKQPLGV SSHLGFGSSQ SPMAMDGVYG TTSHQMENTG 180 YAFGNGGGGM EQMATSDPNR VLWGFPWQMN MGGGSGHGHG HVDQIDSGRE IWSSTVNYIN 240 TGALL |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
At.478 | 0.0 | flower| silique |
Expression -- Microarray ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | E-value | ||||
GEO | 30692617 | 0.0 | ||||
Genevisible | 252586_at | 0.0 | ||||
Expression Atlas | AT3G45610 | - | ||||
AtGenExpress | AT3G45610 | - | ||||
ATTED-II | AT3G45610 | - |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: The transcript levels of the gene accumulate in dry seeds and decay gradually during after-ripening and also upon seed imbibition. {ECO:0000269|PubMed:22155632}. | |||||
Uniprot | TISSUE SPECIFICITY: The PEAR proteins (e.g. DOF2.4, DOF5.1, DOF3.2, DOF1.1, DOF5.6 and DOF5.3) form a short-range concentration gradient that peaks at protophloem sieve elements (PSE). {ECO:0000269|PubMed:30626969}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that negatively affects seed germination and opposes TCP14 function in the regulation of a specific set of abscisic acid-related genes (PubMed:22155632). The PEAR proteins (e.g. DOF2.4, DOF5.1, DOF3.2, DOF1.1, DOF5.6 and DOF5.3) activate gene expression that promotes radial growth of protophloem sieve elements (PubMed:30626969). {ECO:0000269|PubMed:22155632, ECO:0000269|PubMed:30626969}. |
Function -- GeneRIF ? help Back to Top | ||||||
---|---|---|---|---|---|---|
|
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00392 | DAP | 27203113 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | AT3G45610.1 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By cytokinin in procambium. {ECO:0000269|PubMed:30626969}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Interaction ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Intact With | |||||
BioGRID | AT3G47620 |
Phenotype -- Mutation ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | |||||
T-DNA Express | AT3G45610 |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AY062783 | 0.0 | AY062783.1 Arabidopsis thaliana dof6 zinc finger protein (F9K21.19) mRNA, complete cds. | |||
GenBank | BT006284 | 0.0 | BT006284.1 Arabidopsis thaliana At3g45610 mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_190147.1 | 0.0 | Dof-type zinc finger DNA-binding family protein | ||||
Swissprot | Q9M1E6 | 0.0 | DOF32_ARATH; Dof zinc finger protein DOF3.2 | ||||
TrEMBL | A0A178VBA6 | 0.0 | A0A178VBA6_ARATH; DOF6 | ||||
STRING | AT3G45610.1 | 0.0 | (Arabidopsis thaliana) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM6132 | 18 | 45 | Representative plant | OGRP38 | 17 | 445 |
Link Out ? help Back to Top | |
---|---|
Phytozome | AT3G45610.1 |
Entrez Gene | 823703 |
iHOP | AT3G45610 |
wikigenes | AT3G45610 |