Signature Domain? help Back to Top |
|
No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
1 | NAM | 169.6 | 9.7e-53 | 9 | 136 | 1 | 128 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskk 96
l+pGfrFhPtdeelv +yLk+k+ +k++++ ++i+ +d+yk+ePwdLp k ++k+++ ewyfFs dkky++g+++nrat+ gyWk+tgkd+e+l+ +
AT3G10500.1 9 LAPGFRFHPTDEELVRYYLKRKICNKPFKF-DAISVTDVYKSEPWDLPdKsRLKSRDLEWYFFSMLDKKYRNGSKTNRATEMGYWKTTGKDREILN-G 104
579**************************9.99**************96347777888**************************************.9 PP
NAM 97 gelvglkktLvfykgrapkgektdWvmheyrl 128
+++vg+kktLv++kgrap+ge+t+Wvmheyrl
AT3G10500.1 105 SKVVGMKKTLVYHKGRAPRGERTNWVMHEYRL 136
******************************98 PP
|
3D Structure ? help Back to Top |
|
PDB ID |
Evalue |
Query Start |
Query End |
Hit Start |
Hit End |
Description |
1ut4_A | 3e-45 | 8 | 165 | 16 | 171 | NO APICAL MERISTEM PROTEIN |
1ut4_B | 3e-45 | 8 | 165 | 16 | 171 | NO APICAL MERISTEM PROTEIN |
1ut7_A | 3e-45 | 8 | 165 | 16 | 171 | NO APICAL MERISTEM PROTEIN |
1ut7_B | 3e-45 | 8 | 165 | 16 | 171 | NO APICAL MERISTEM PROTEIN |
3swm_A | 3e-45 | 8 | 165 | 19 | 174 | NAC domain-containing protein 19 |
3swm_B | 3e-45 | 8 | 165 | 19 | 174 | NAC domain-containing protein 19 |
3swm_C | 3e-45 | 8 | 165 | 19 | 174 | NAC domain-containing protein 19 |
3swm_D | 3e-45 | 8 | 165 | 19 | 174 | NAC domain-containing protein 19 |
3swp_A | 3e-45 | 8 | 165 | 19 | 174 | NAC domain-containing protein 19 |
3swp_B | 3e-45 | 8 | 165 | 19 | 174 | NAC domain-containing protein 19 |
3swp_C | 3e-45 | 8 | 165 | 19 | 174 | NAC domain-containing protein 19 |
3swp_D | 3e-45 | 8 | 165 | 19 | 174 | NAC domain-containing protein 19 |
4dul_A | 3e-45 | 8 | 165 | 16 | 171 | NAC domain-containing protein 19 |
4dul_B | 3e-45 | 8 | 165 | 16 | 171 | NAC domain-containing protein 19 |
Search in ModeBase |
Publications
? help Back to Top |
- Riechmann JL, et al.
Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes. Science, 2000. 290(5499): p. 2105-10 [PMID:11118137] - Yamada K, et al.
Empirical analysis of transcriptional activity in the Arabidopsis genome. Science, 2003. 302(5646): p. 842-6 [PMID:14593172] - Ooka H, et al.
Comprehensive analysis of NAC family genes in Oryza sativa and Arabidopsis thaliana. DNA Res., 2003. 10(6): p. 239-47 [PMID:15029955] - Hampton CR, et al.
Cesium toxicity in Arabidopsis. Plant Physiol., 2004. 136(3): p. 3824-37 [PMID:15489280] - Baerson SR, et al.
Detoxification and transcriptome response in Arabidopsis seedlings exposed to the allelochemical benzoxazolin-2(3H)-one. J. Biol. Chem., 2005. 280(23): p. 21867-81 [PMID:15824099] - Ohashi-Ito K,Kubo M,Demura T,Fukuda H
Class III homeodomain leucine-zipper proteins regulate xylem cell differentiation. Plant Cell Physiol., 2005. 46(10): p. 1646-56 [PMID:16081527] - Davletova S,Schlauch K,Coutu J,Mittler R
The zinc-finger protein Zat12 plays a central role in reactive oxygen and abiotic stress signaling in Arabidopsis. Plant Physiol., 2005. 139(2): p. 847-56 [PMID:16183833] - Lee BH,Henderson DA,Zhu JK
The Arabidopsis cold-responsive transcriptome and its regulation by ICE1. Plant Cell, 2005. 17(11): p. 3155-75 [PMID:16214899] - Vergnolle C, et al.
The cold-induced early activation of phospholipase C and D pathways determines the response of two distinct clusters of genes in Arabidopsis cell suspensions. Plant Physiol., 2005. 139(3): p. 1217-33 [PMID:16258011] - Duarte JM, et al.
Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] - Lindqvist C, et al.
An expressed sequence tag (EST) library from developing fruits of an Hawaiian endemic mint (Stenogyne rugosa, Lamiaceae): characterization and microsatellite markers. BMC Plant Biol., 2006. 6: p. 16 [PMID:16928278] - Kim SY, et al.
Exploring membrane-associated NAC transcription factors in Arabidopsis: implications for membrane biology in genome regulation. Nucleic Acids Res., 2007. 35(1): p. 203-13 [PMID:17158162] - Culligan KM,Robertson CE,Foreman J,Doerner P,Britt AB
ATR and ATM play both distinct and additive roles in response to ionizing radiation. Plant J., 2006. 48(6): p. 947-61 [PMID:17227549] - Fleury D, et al.
The Arabidopsis thaliana homolog of yeast BRE1 has a function in cell cycle regulation during early leaf and root growth. Plant Cell, 2007. 19(2): p. 417-32 [PMID:17329565] - Ascencio-Ib
Global analysis of Arabidopsis gene expression uncovers a complex array of changes impacting pathogen response and cell cycle during geminivirus infection. Plant Physiol., 2008. 148(1): p. 436-54 [PMID:18650403] - Inz
A subcellular localization compendium of hydrogen peroxide-induced proteins. Plant Cell Environ., 2012. 35(2): p. 308-20 [PMID:21443605] - Lee S,Seo PJ,Lee HJ,Park CM
A NAC transcription factor NTL4 promotes reactive oxygen species production during drought-induced leaf senescence in Arabidopsis. Plant J., 2012. 70(5): p. 831-44 [PMID:22313226] - Lee S,Park CM
Regulation of reactive oxygen species generation under drought conditions in Arabidopsis. Plant Signal Behav, 2012. 7(6): p. 599-601 [PMID:22580707] - Shih CF,Hsu WH,Peng YJ,Yang CH
The NAC-like gene ANTHER INDEHISCENCE FACTOR acts as a repressor that controls anther dehiscence by regulating genes in the jasmonate biosynthesis pathway in Arabidopsis. J. Exp. Bot., 2014. 65(2): p. 621-39 [PMID:24323506] - Ding Y, et al.
Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] - Lee S, et al.
The Arabidopsis NAC transcription factor NTL4 participates in a positive feedback loop that induces programmed cell death under heat stress conditions. Plant Sci., 2014. 227: p. 76-83 [PMID:25219309] - Vermeirssen V,De Clercq I,Van Parys T,Van Breusegem F,Van de Peer Y
Arabidopsis ensemble reverse-engineered gene regulatory network discloses interconnected transcription factors in oxidative stress. Plant Cell, 2014. 26(12): p. 4656-79 [PMID:25549671] - Gladman NP,Marshall RS,Lee KH,Vierstra RD
The Proteasome Stress Regulon Is Controlled by a Pair of NAC Transcription Factors in Arabidopsis. Plant Cell, 2016. 28(6): p. 1279-96 [PMID:27194708] - Sanz-Fernández M, et al.
Screening Arabidopsis mutants in genes useful for phytoremediation. J. Hazard. Mater., 2017. 335: p. 143-151 [PMID:28441590]
|