PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

AT3G05860.3

Common Name

F10A16.16

Organism

Arabidopsis thaliana

Taxonomic ID

3702

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis

Family

M-type_MADS

Protein Properties

Length: 249aa MW: 29182 Da PI: 7.3793

Description

M-type_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
AT3G05860.3	genome	TAIR	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	54.1	2e-17	11	50	3	42
--SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-T CS SRF-TF 3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifss 42 i n+s r+ tf kR++g+ KK +ELSvLC++e++ +i+s+ AT3G05860.3 11 ITNESMRKATFNKRKKGLVKKIHELSVLCGIEACAVIYSP 50 89*************************************8 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS50066	17.703	1	49	IPR002100	Transcription factor, MADS-box
SMART	SM00432	3.4E-24	1	60	IPR002100	Transcription factor, MADS-box
CDD	cd00266	7.87E-34	2	85	No hit	No description
SuperFamily	SSF55455	4.19E-24	2	94	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	1.3E-10	3	23	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	1.8E-17	11	51	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	1.3E-10	23	38	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	1.3E-10	38	59	IPR002100	Transcription factor, MADS-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Plant Ontology ? help Back to Top
PO Term	PO Category	PO Description
PO:0009009	anatomy	plant embryo
PO:0009089	anatomy	endosperm

Sequence ? help Back to Top
Protein Sequence Length: 249 aa Download sequence Send to blast
MTRKKLNLSY ITNESMRKAT FNKRKKGLVK KIHELSVLCG IEACAVIYSP FNSNPEVWPS 60 NSEVKNVMEN FEMLTKLEQE KKMVSHEGFI RQNISKTMES NNKKMIDNAE RTMKEAMFQL 120 LSGKGEKLNL TDRNREDLCK YIDQYLKELY HHKNKTINQS HIEPGESSGA TNAMTPTSVV 180 ENPNFNHLSH NQYQYQQQFG YPILVQDGIY NPSQIQNQHE EWLDDHMMNH SKEISHPLMD 240 DNNFYYQQP

Expression -- Microarray ? help Back to Top
Source	ID	E-value
Genevisible	258734_at	0.0
Expression Atlas	AT3G05860	-
AtGenExpress	AT3G05860	-
ATTED-II	AT3G05860	-

Expression -- Description ? help Back to Top
Source	Description
Uniprot	TISSUE SPECIFICITY: Expressed in the central cell of the female gametophyte and in early endosperm. Also detected in ovaries, young siliques, roots, leaves, stems, young flowers and anthers. {ECO:0000269\|PubMed:16798889}.

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor. Controls central cell differentiation during female gametophyte development. Required for the expression of DEMETER and DD46, but not for the expression of FIS2 (PubMed:16798889). Probable transcription factor that may function in the maintenance of the proper function of the central cell in pollen tube attraction (Probable). {ECO:0000269\|PubMed:16798889, ECO:0000305\|PubMed:26462908}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	AT3G05860.3

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Interaction ? help Back to Top
Source	Intact With
BioGRID	AT4G36590

Phenotype -- Mutation ? help Back to Top
Source	ID
T-DNA Express	AT3G05860

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	ATAC012393	0.0	AC012393.5 Arabidopsis thaliana chromosome III BAC F10A16 genomic sequence, complete sequence.
GenBank	CP002686	0.0	CP002686.1 Arabidopsis thaliana chromosome 3, complete sequence.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	NP_001118585.1	0.0	MADS-box transcription factor family protein
Swissprot	Q9FJK3	2e-45	AGL80_ARATH; Agamous-like MADS-box protein AGL80
TrEMBL	Q9M9L1	0.0	Q9M9L1_ARATH; MADS-box transcription factor family protein
STRING	AT3G05860.1	1e-177	(Arabidopsis thaliana)

Link Out ? help Back to Top
Phytozome	AT3G05860.3
Entrez Gene	819755
iHOP	AT3G05860
wikigenes	AT3G05860

Publications ? help Back to Top
Riechmann JL, et al. Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes. Science, 2000. 290(5499): p. 2105-10 [PMID:11118137] De Bodt S, et al. Genomewide structural annotation and evolutionary analysis of the type I MADS-box genes in plants. J. Mol. Evol., 2003. 56(5): p. 573-86 [PMID:12698294] Parenicová L, et al. Molecular and phylogenetic analyses of the complete MADS-box transcription factor family in Arabidopsis: new openings to the MADS world. Plant Cell, 2003. 15(7): p. 1538-51 [PMID:12837945] Kofuji R, et al. Evolution and divergence of the MADS-box gene family based on genome-wide expression analyses. Mol. Biol. Evol., 2003. 20(12): p. 1963-77 [PMID:12949148] de Folter S, et al. Comprehensive interaction map of the Arabidopsis MADS Box transcription factors. Plant Cell, 2005. 17(5): p. 1424-33 [PMID:15805477] Day RC,Herridge RP,Ambrose BA,Macknight RC Transcriptome analysis of proliferating Arabidopsis endosperm reveals biological implications for the control of syncytial division, cytokinin signaling, and gene expression regulation. Plant Physiol., 2008. 148(4): p. 1964-84 [PMID:18923020] Bemer M,Heijmans K,Airoldi C,Davies B,Angenent GC An atlas of type I MADS box gene expression during female gametophyte and seed development in Arabidopsis. Plant Physiol., 2010. 154(1): p. 287-300 [PMID:20631316] Zhang S, et al. FERTILIZATION-INDEPENDENT SEED-Polycomb Repressive Complex 2 Plays a Dual Role in Regulating Type I MADS-Box Genes in Early Endosperm Development. Plant Physiol., 2018. 177(1): p. 285-299 [PMID:29523711]