PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | AT2G46590.1 | ||||||||
Common Name | DAG2, DOF2.5, F13A10.12 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
|
||||||||
Family | Dof | ||||||||
Protein Properties | Length: 357aa MW: 39113.9 Da PI: 9.3456 | ||||||||
Description | Dof family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | zf-Dof | 123.7 | 6.1e-39 | 64 | 125 | 2 | 63 |
zf-Dof 2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkksss 63 ++++l+cprC+stntkfCyynnysl+qPryfCk+CrryWt+GG+lrnvPvGg++rknk+sss AT2G46590.1 64 PQEKLNCPRCNSTNTKFCYYNNYSLTQPRYFCKGCRRYWTEGGSLRNVPVGGSSRKNKRSSS 125 6899******************************************************9875 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
ProDom | PD007478 | 2.0E-26 | 63 | 115 | IPR003851 | Zinc finger, Dof-type |
Pfam | PF02701 | 5.9E-33 | 66 | 122 | IPR003851 | Zinc finger, Dof-type |
PROSITE profile | PS50884 | 28.901 | 68 | 122 | IPR003851 | Zinc finger, Dof-type |
PROSITE pattern | PS01361 | 0 | 70 | 106 | IPR003851 | Zinc finger, Dof-type |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0009409 | Biological Process | response to cold | ||||
GO:0009416 | Biological Process | response to light stimulus | ||||
GO:0009845 | Biological Process | seed germination | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046872 | Molecular Function | metal ion binding |
Plant Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PO Term | PO Category | PO Description | ||||
PO:0000013 | anatomy | cauline leaf | ||||
PO:0000034 | anatomy | vascular system | ||||
PO:0000037 | anatomy | shoot apex | ||||
PO:0000230 | anatomy | inflorescence meristem | ||||
PO:0000293 | anatomy | guard cell | ||||
PO:0008019 | anatomy | leaf lamina base | ||||
PO:0009005 | anatomy | root | ||||
PO:0009006 | anatomy | shoot system | ||||
PO:0009009 | anatomy | plant embryo | ||||
PO:0009010 | anatomy | seed | ||||
PO:0009025 | anatomy | vascular leaf | ||||
PO:0009029 | anatomy | stamen | ||||
PO:0009030 | anatomy | carpel | ||||
PO:0009031 | anatomy | sepal | ||||
PO:0009032 | anatomy | petal | ||||
PO:0009046 | anatomy | flower | ||||
PO:0009047 | anatomy | stem | ||||
PO:0009052 | anatomy | flower pedicel | ||||
PO:0020030 | anatomy | cotyledon | ||||
PO:0020038 | anatomy | petiole | ||||
PO:0020100 | anatomy | hypocotyl | ||||
PO:0020137 | anatomy | leaf apex | ||||
PO:0025022 | anatomy | collective leaf structure | ||||
PO:0025281 | anatomy | pollen | ||||
PO:0001054 | developmental stage | vascular leaf senescent stage | ||||
PO:0001078 | developmental stage | plant embryo cotyledonary stage | ||||
PO:0001081 | developmental stage | mature plant embryo stage | ||||
PO:0001185 | developmental stage | plant embryo globular stage | ||||
PO:0004507 | developmental stage | plant embryo bilateral stage | ||||
PO:0007064 | developmental stage | LP.12 twelve leaves visible stage | ||||
PO:0007095 | developmental stage | LP.08 eight leaves visible stage | ||||
PO:0007098 | developmental stage | LP.02 two leaves visible stage | ||||
PO:0007103 | developmental stage | LP.10 ten leaves visible stage | ||||
PO:0007115 | developmental stage | LP.04 four leaves visible stage | ||||
PO:0007611 | developmental stage | petal differentiation and expansion stage | ||||
PO:0007616 | developmental stage | flowering stage |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 357 aa Download sequence Send to blast |
MMNVKPMEQI MIPNNNTHQP NTTSNARPNT ILTSNGVSTA GATVSGVSNN NNNTAVVAER 60 KARPQEKLNC PRCNSTNTKF CYYNNYSLTQ PRYFCKGCRR YWTEGGSLRN VPVGGSSRKN 120 KRSSSSSSSN ILQTIPSSLP DLNPPILFSN QIHNKSKGSS QDLNLLSFPV MQDQHHHHVH 180 MSQFLQMPKM EGNGNITHQQ QPSSSSSVYG SSSSPVSALE LLRTGVNVSS RSGINSSFMP 240 SGSMMDSNTV LYTSSGFPTM VDYKPSNLSF STDHQGLGHN SNNRSEALHS DHHQQGRVLF 300 PFGDQMKELS SSITQEVDHD DNQQQKSHGN NNNNNNSSPN NGYWSGMFST TGGGSSW |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
At.43221 | 0.0 | flower |
Expression -- Microarray ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | E-value | ||||
Genevisible | 265448_at | 0.0 | ||||
Expression Atlas | AT2G46590 | - | ||||
AtGenExpress | AT2G46590 | - | ||||
ATTED-II | AT2G46590 | - |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: Turned off in siliques when they reached full maturation. Not expressed in developing or mature embryos. | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in the vascular system of the mother plant, but not present in the seed and embryo. In maturing siliques, found all through the funiculus connecting the placenta to the ovule, but not in the ovule. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
TAIR | encodes a protein containing Dof zinc finger motifs. expression is limited to vascular system of the mother plant. recessive mutation is inherited as maternal-effect and expression is not detected in the embryo. mutants are defective in seed germination. mutants are more dependent on light and cold treatment and less sensitive to gibberellin during seed germination. | |||||
UniProt | Transcription factor specifically involved in the maternal control of seed germination. Regulates transcription by binding to a 5'-AA[AG]G-3' consensus core sequence. May ensure the activation of a component that would trigger germination as a consequence of red light perception. |
Function -- GeneRIF ? help Back to Top | ||||||
---|---|---|---|---|---|---|
|
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00319 | DAP | 27203113 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | AT2G46590.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Phenotype -- Mutation ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | |||||
T-DNA Express | AT2G46590 |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AC006418 | 0.0 | AC006418.4 Arabidopsis thaliana chromosome 2 clone F13A10 map CIC06C03, complete sequence. | |||
GenBank | AJ237810 | 0.0 | AJ237810.1 Arabidopsis thaliana dag2 gene, exons 1-2. | |||
GenBank | BT003328 | 0.0 | BT003328.1 Arabidopsis thaliana putative DOF zinc finger protein (At2g46590) mRNA, complete cds. | |||
GenBank | BT008842 | 0.0 | BT008842.1 Arabidopsis thaliana At2g46590 mRNA, complete cds. | |||
GenBank | CP002685 | 0.0 | CP002685.1 Arabidopsis thaliana chromosome 2, complete sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_182182.2 | 0.0 | Dof-type zinc finger DNA-binding family protein | ||||
Swissprot | Q9ZPY0 | 0.0 | DOF25_ARATH; Dof zinc finger protein DOF2.5 | ||||
TrEMBL | A0A178VWF7 | 0.0 | A0A178VWF7_ARATH; DAG2 | ||||
STRING | AT2G46590.2 | 0.0 | (Arabidopsis thaliana) |
Link Out ? help Back to Top | |
---|---|
Phytozome | AT2G46590.1 |
Entrez Gene | 819271 |
iHOP | AT2G46590 |
wikigenes | AT2G46590 |