PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

AT2G38250.1

Common Name

F16M14.18, GT1L, GT3B, GT-3B

Organism

Arabidopsis thaliana

Taxonomic ID

3702

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis

Family

Trihelix

Protein Properties

Length: 289aa MW: 34307.4 Da PI: 7.0249

Description

Trihelix family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
AT2G38250.1	genome	TAIR	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	trihelix	83.7	2.3e-26	41	123	1	86
trihelix 1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqle 86 +W+ +e+++Li +r e+++++ ++k++k lWe +s+kmr++ f rsp+qCk+kw+nl +r+k ++++e + +++++p++d+++ AT2G38250.1 41 QWSVEETKELIGIRGELDQTFMETKRNKLLWEVISNKMRDKSFPRSPEQCKCKWKNLVTRFKGCETMEAET---ARQQFPFYDDMQ 123 7******************************************************************84...56679****8 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00717	0.0048	38	100	IPR001005	SANT/Myb domain
CDD	cd12203	2.90E-22	40	105	No hit	No description
Pfam	PF13837	8.4E-21	41	124	No hit	No description
PROSITE profile	PS50090	7.631	42	98	IPR017877	Myb-like domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005730	Cellular Component	nucleolus
GO:0016592	Cellular Component	mediator complex
GO:0003677	Molecular Function	DNA binding
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0005515	Molecular Function	protein binding

Plant Ontology ? help Back to Top
PO Term	PO Category	PO Description
PO:0000293	anatomy	guard cell
PO:0009029	anatomy	stamen
PO:0007611	developmental stage	petal differentiation and expansion stage
PO:0007616	developmental stage	flowering stage

Sequence ? help Back to Top
Protein Sequence Length: 289 aa Download sequence Send to blast
MDGHQHHHLH QLQYLNKHHL HTQSQTPEIA SPVAVGDRFP QWSVEETKEL IGIRGELDQT 60 FMETKRNKLL WEVISNKMRD KSFPRSPEQC KCKWKNLVTR FKGCETMEAE TARQQFPFYD 120 DMQNIFTTRM QRMLWAESEG GGGGTSGAAR KREYSSDEEE ENVNEELVDV SNDPKILNPK 180 KNIAKKRKGG SNSSNSNNGV REVLEEFMRH QVRMESEWRE GWEAREKERA EKEEEWRRKM 240 EELEKERLAM ERMWRDREEQ RRSREEMRAE KRDSLINALL AKLTRDGSL

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
2ebi_A	4e-13	38	119	3	84	DNA binding protein GT-1
Search in ModeBase

Nucleic Localization Signal ? help Back to Top

No.	Start	End	Sequence
1	178	187	PKKNIAKKRK

Expression -- UniGene ? help Back to Top
UniGene ID	E-value	Expressed in
At.28319	0.0	seed

Expression -- Microarray ? help Back to Top
Source	ID	E-value
GEO	186506346	0.0
Genevisible	267140_at	0.0
Expression Atlas	AT2G38250	-
AtGenExpress	AT2G38250	-
ATTED-II	AT2G38250	-

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor that may play a role in the induction of CAM4 in response to pathogen and salt. {ECO:0000269\|PubMed:15310827}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	AT2G38250.1

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By salt and infection with the bacterial pathogen P.syringae pv tomato. {ECO:0000269\|PubMed:15310827}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Interaction ? help Back to Top
Source	Intact With
IntAct	Search O80450

Phenotype -- Mutation ? help Back to Top
Source	ID
T-DNA Express	AT2G38250

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AF453582	0.0	AF453582.1 Arabidopsis thaliana GT-1 like transcription factor (GT1L) mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	NP_181360.1	0.0	Homeodomain-like superfamily protein
Swissprot	O80450	0.0	TGT3B_ARATH; Trihelix transcription factor GT-3b
TrEMBL	A0A178VPR5	0.0	A0A178VPR5_ARATH; Uncharacterized protein
STRING	AT2G38250.1	0.0	(Arabidopsis thaliana)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM2215	28	70
Representative plant	OGRP2262	15	35

Link Out ? help Back to Top
Phytozome	AT2G38250.1
Entrez Gene	818404
iHOP	AT2G38250
wikigenes	AT2G38250

Publications ? help Back to Top
Riechmann JL, et al. Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes. Science, 2000. 290(5499): p. 2105-10 [PMID:11118137] Ayadi M,Delaporte V,Li YF,Zhou DX Analysis of GT-3a identifies a distinct subgroup of trihelix DNA-binding transcription factors in Arabidopsis. FEBS Lett., 2004. 562(1-3): p. 147-54 [PMID:15044016] Park HC, et al. Pathogen- and NaCl-induced expression of the SCaM-4 promoter is mediated in part by a GT-1 box that interacts with a GT-1-like transcription factor. Plant Physiol., 2004. 135(4): p. 2150-61 [PMID:15310827] Pendle AF, et al. Proteomic analysis of the Arabidopsis nucleolus suggests novel nucleolar functions. Mol. Biol. Cell, 2005. 16(1): p. 260-9 [PMID:15496452] Vanderauwera S, et al. Genome-wide analysis of hydrogen peroxide-regulated gene expression in Arabidopsis reveals a high light-induced transcriptional cluster involved in anthocyanin biosynthesis. Plant Physiol., 2005. 139(2): p. 806-21 [PMID:16183842] Truman W,de Zabala MT,Grant M Type III effectors orchestrate a complex interplay between transcriptional networks to modify basal defence responses during pathogenesis and resistance. Plant J., 2006. 46(1): p. 14-33 [PMID:16553893] Thilmony R,Underwood W,He SY Genome-wide transcriptional analysis of the Arabidopsis thaliana interaction with the plant pathogen Pseudomonas syringae pv. tomato DC3000 and the human pathogen Escherichia coli O157:H7. Plant J., 2006. 46(1): p. 34-53 [PMID:16553894] van de Mortel JE, et al. Large expression differences in genes for iron and zinc homeostasis, stress response, and lignin biosynthesis distinguish roots of Arabidopsis thaliana and the related metal hyperaccumulator Thlaspi caerulescens. Plant Physiol., 2006. 142(3): p. 1127-47 [PMID:16998091] Culligan KM,Robertson CE,Foreman J,Doerner P,Britt AB ATR and ATM play both distinct and additive roles in response to ionizing radiation. Plant J., 2006. 48(6): p. 947-61 [PMID:17227549] B Purification of a plant mediator from Arabidopsis thaliana identifies PFT1 as the Med25 subunit. Mol. Cell, 2007. 26(5): p. 717-29 [PMID:17560376] Barakat A,Wall PK,Diloreto S,Depamphilis CW,Carlson JE Conservation and divergence of microRNAs in Populus. BMC Genomics, 2007. 8: p. 481 [PMID:18166134] Gandia-Herrero F, et al. Detoxification of the explosive 2,4,6-trinitrotoluene in Arabidopsis: discovery of bifunctional O- and C-glucosyltransferases. Plant J., 2008. 56(6): p. 963-74 [PMID:18702669] Inz A subcellular localization compendium of hydrogen peroxide-induced proteins. Plant Cell Environ., 2012. 35(2): p. 308-20 [PMID:21443605] Efroni I, et al. Regulation of leaf maturation by chromatin-mediated modulation of cytokinin responses. Dev. Cell, 2013. 24(4): p. 438-45 [PMID:23449474] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444]