PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | AT2G37060.1 | ||||||||
Common Name | NFYB8, NF-YB8, T2N18.18 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 173aa MW: 18998.3 Da PI: 6.9337 | ||||||||
Description | nuclear factor Y, subunit B8 | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 184.5 | 8.3e-58 | 28 | 125 | 1 | 98 |
NF-YB 1 vreqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelegekk 98 vreqdrflPian+srimk+ lPan+ki+kdake+vqecvsefisfvtseasdkcqrekrktingddllwa+atlGfedy+eplkvyl++yre+eg++k AT2G37060.1 28 VREQDRFLPIANISRIMKRGLPANGKIAKDAKEIVQECVSEFISFVTSEASDKCQREKRKTINGDDLLWAMATLGFEDYMEPLKVYLMRYREMEGDTK 125 69*********************************************************************************************975 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 7.9E-54 | 26 | 158 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 8.24E-41 | 31 | 149 | IPR009072 | Histone-fold |
Pfam | PF00808 | 2.4E-27 | 34 | 98 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 4.7E-21 | 62 | 80 | No hit | No description |
PROSITE pattern | PS00685 | 0 | 65 | 81 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
PRINTS | PR00615 | 4.7E-21 | 81 | 99 | No hit | No description |
PRINTS | PR00615 | 4.7E-21 | 100 | 118 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Plant Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PO Term | PO Category | PO Description | ||||
PO:0000293 | anatomy | guard cell | ||||
PO:0025195 | anatomy | pollen tube cell | ||||
PO:0025281 | anatomy | pollen | ||||
PO:0001017 | developmental stage | M germinated pollen stage |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 173 aa Download sequence Send to blast |
MAESQAKSPG GCGSHESGGD QSPRSLHVRE QDRFLPIANI SRIMKRGLPA NGKIAKDAKE 60 IVQECVSEFI SFVTSEASDK CQREKRKTIN GDDLLWAMAT LGFEDYMEPL KVYLMRYREM 120 EGDTKGSAKG GDPNAKKDGQ SSQNGQFSQL AHQGPYGNSQ AQQHMMVPMP GTD |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4awl_B | 1e-46 | 26 | 119 | 1 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
4csr_A | 1e-46 | 26 | 119 | 1 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
4g91_B | 1e-46 | 28 | 119 | 1 | 92 | Transcription factor HapC (Eurofung) |
4g92_B | 1e-46 | 28 | 119 | 1 | 92 | Transcription factor HapC (Eurofung) |
Search in ModeBase |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
At.28391 | 0.0 | flower| root |
Expression -- Microarray ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | E-value | ||||
Genevisible | 265466_at | 0.0 | ||||
Expression Atlas | AT2G37060 | - | ||||
AtGenExpress | AT2G37060 | - |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in flowers and mature rosettes. {ECO:0000269|PubMed:11250072}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | AT2G37060.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Interaction ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Intact With | |||||
BioGRID | AT3G48590, AT5G27910, AT5G38140, AT5G50470, AT5G50480, AT5G50490, AT5G63470, AT1G08970, AT1G54830, AT1G56170 |
Phenotype -- Mutation ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | |||||
T-DNA Express | AT2G37060 |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AY070477 | 0.0 | AY070477.1 Arabidopsis thaliana At2g37060/T2N18.18 mRNA, complete cds. | |||
GenBank | AY091673 | 0.0 | AY091673.1 Arabidopsis thaliana At2g37060/T2N18.18 mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_001031500.1 | 1e-128 | nuclear factor Y, subunit B8 | ||||
Refseq | NP_850277.2 | 1e-128 | nuclear factor Y, subunit B8 | ||||
Refseq | NP_973617.1 | 1e-128 | nuclear factor Y, subunit B8 | ||||
Swissprot | Q8VYK4 | 1e-129 | NFYB8_ARATH; Nuclear transcription factor Y subunit B-8 | ||||
TrEMBL | A0A178VR64 | 1e-126 | A0A178VR64_ARATH; NF-YB8 | ||||
STRING | AT2G37060.3 | 1e-128 | (Arabidopsis thaliana) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM1480 | 27 | 94 | Representative plant | OGRP168 | 17 | 170 |
Link Out ? help Back to Top | |
---|---|
Phytozome | AT2G37060.1 |
Entrez Gene | 818282 |
iHOP | AT2G37060 |
wikigenes | AT2G37060 |