Signature Domain? help Back to Top |
|
No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
1 | Homeobox | 29.2 | 1.5e-09 | 405 | 442 | 19 | 54 |
HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
Homeobox 19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54
Fe ++yp+ +++ LAk++gLt +qV++WF N R +
AT2G35940.3 405 FEHflHPYPKDSDKHMLAKQTGLTRSQVSNWFINARVR 442
554459******************************88 PP
|
2 | BELL | 122.7 | 1.5e-39 | 264 | 335 | 1 | 72 |
BELL 1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72
erqe+q+kkakL ++l+eV++rY+qy++q+q+vissFe++ag+gsak+YtslAlk+iSr+FrcLk+aia+qi
AT2G35940.3 264 ERQEIQMKKAKLSNMLHEVEQRYRQYHQQMQMVISSFEQAAGIGSAKSYTSLALKTISRQFRCLKEAIAGQI 335
79*********************************************************************8 PP
|
Publications
? help Back to Top |
- Riechmann JL, et al.
Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes. Science, 2000. 290(5499): p. 2105-10 [PMID:11118137] - Che P,Gingerich DJ,Lall S,Howell SH
Global and hormone-induced gene expression changes during shoot development in Arabidopsis. Plant Cell, 2002. 14(11): p. 2771-85 [PMID:12417700] - Hoth S, et al.
Genome-wide gene expression profiling in Arabidopsis thaliana reveals new targets of abscisic acid and largely impaired gene regulation in the abi1-1 mutant. J. Cell. Sci., 2002. 115(Pt 24): p. 4891-900 [PMID:12432076] - Yamada K, et al.
Empirical analysis of transcriptional activity in the Arabidopsis genome. Science, 2003. 302(5646): p. 842-6 [PMID:14593172] - Hoth S, et al.
Monitoring genome-wide changes in gene expression in response to endogenous cytokinin reveals targets in Arabidopsis thaliana. FEBS Lett., 2003. 554(3): p. 373-80 [PMID:14623097] - Smith HM,Campbell BC,Hake S
Competence to respond to floral inductive signals requires the homeobox genes PENNYWISE and POUND-FOOLISH. Curr. Biol., 2004. 14(9): p. 812-7 [PMID:15120075] - Ko JH,Han KH,Park S,Yang J
Plant body weight-induced secondary growth in Arabidopsis and its transcription phenotype revealed by whole-transcriptome profiling. Plant Physiol., 2004. 135(2): p. 1069-83 [PMID:15194820] - Guan Y,Nothnagel EA
Binding of arabinogalactan proteins by Yariv phenylglycoside triggers wound-like responses in Arabidopsis cell cultures. Plant Physiol., 2004. 135(3): p. 1346-66 [PMID:15235117] - Pagnussat GC, et al.
Genetic and molecular identification of genes required for female gametophyte development and function in Arabidopsis. Development, 2005. 132(3): p. 603-14 [PMID:15634699] - Sherameti I, et al.
The endophytic fungus Piriformospora indica stimulates the expression of nitrate reductase and the starch-degrading enzyme glucan-water dikinase in tobacco and Arabidopsis roots through a homeodomain transcription factor that binds to a conserved motif in their promoters. J. Biol. Chem., 2005. 280(28): p. 26241-7 [PMID:15710607] - Hackbusch J,Richter K,Müller J,Salamini F,Uhrig JF
A central role of Arabidopsis thaliana ovate family proteins in networking and subcellular localization of 3-aa loop extension homeodomain proteins. Proc. Natl. Acad. Sci. U.S.A., 2005. 102(13): p. 4908-12 [PMID:15781858] - Vergnolle C, et al.
The cold-induced early activation of phospholipase C and D pathways determines the response of two distinct clusters of genes in Arabidopsis cell suspensions. Plant Physiol., 2005. 139(3): p. 1217-33 [PMID:16258011] - Duarte JM, et al.
Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] - Rigola D,Fiers M,Vurro E,Aarts MG
The heavy metal hyperaccumulator Thlaspi caerulescens expresses many species-specific genes, as identified by comparative expressed sequence tag analysis. New Phytol., 2006. 170(4): p. 753-65 [PMID:16684236] - Shahollari B,Vadassery J,Varma A,Oelmüller R
A leucine-rich repeat protein is required for growth promotion and enhanced seed production mediated by the endophytic fungus Piriformospora indica in Arabidopsis thaliana. Plant J., 2007. 50(1): p. 1-13 [PMID:17397506] - Kumar R, et al.
The Arabidopsis BEL1-LIKE HOMEODOMAIN proteins SAW1 and SAW2 act redundantly to regulate KNOX expression spatially in leaf margins. Plant Cell, 2007. 19(9): p. 2719-35 [PMID:17873098] - Pagnussat GC,Yu HJ,Sundaresan V
Cell-fate switch of synergid to egg cell in Arabidopsis eostre mutant embryo sacs arises from misexpression of the BEL1-like homeodomain gene BLH1. Plant Cell, 2007. 19(11): p. 3578-92 [PMID:18055603] - Huang D,Wu W,Abrams SR,Cutler AJ
The relationship of drought-related gene expression in Arabidopsis thaliana to hormonal and environmental factors. J. Exp. Bot., 2008. 59(11): p. 2991-3007 [PMID:18552355] - Ascencio-Ib
Global analysis of Arabidopsis gene expression uncovers a complex array of changes impacting pathogen response and cell cycle during geminivirus infection. Plant Physiol., 2008. 148(1): p. 436-54 [PMID:18650403] - Staneloni RJ, et al.
Bell-like homeodomain selectively regulates the high-irradiance response of phytochrome A. Proc. Natl. Acad. Sci. U.S.A., 2009. 106(32): p. 13624-9 [PMID:19666535] - Arabidopsis Interactome Mapping Consortium
Evidence for network evolution in an Arabidopsis interactome map. Science, 2011. 333(6042): p. 601-7 [PMID:21798944] - Wang S, et al.
Arabidopsis ovate family proteins, a novel transcriptional repressor family, control multiple aspects of plant growth and development. PLoS ONE, 2011. 6(8): p. e23896 [PMID:21886836] - Smaczniak C, et al.
Characterization of MADS-domain transcription factor complexes in Arabidopsis flower development. Proc. Natl. Acad. Sci. U.S.A., 2012. 109(5): p. 1560-5 [PMID:22238427] - Kim D, et al.
BLH1 and KNAT3 modulate ABA responses during germination and early seedling development in Arabidopsis. Plant J., 2013. 75(5): p. 755-66 [PMID:23663178] - Ding Y, et al.
Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444]
|