PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | AT2G35550.3 | ||||||||
Common Name | ATBPC7, BBR, BPC7, T32F12.7 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
|
||||||||
Family | BBR-BPC | ||||||||
Protein Properties | Length: 226aa MW: 24813.4 Da PI: 10.5062 | ||||||||
Description | basic pentacysteine 7 | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | GAGA_bind | 280.2 | 9.4e-86 | 27 | 226 | 93 | 301 |
GAGA_bind 93 salpvgvqvlsgtksidslqqlsepqledsave.lreeeklealpieeaaeeakekkkkkkrqrakkpkekkakkkkkksekskkkvkkesaderska 189 + +++ ++++t+ id +q+ ++a++ + +++l +pi++++++++++k+k+ +q+++k++++k ++kk+ ++s+k++k++s +++k+ AT2G35550.3 27 AHWLHSCIAVPKTTGIDLSQE-------PPAEGvMVPQSHLFPPPIRDSRNDTETVKQKSVNQSPSKALKPKPQRKKR--SVSNKSKKTPSI-PETKR 114 344456777888888887666.......67777889999***********************************9999..788899999998.699** PP GAGA_bind 190 ekksidlvlngvslDestlPvPvCsCtGalrqCYkWGnGGWqSaCCtttiSvyPLPvstkrrgaRiagrKmSqgafkklLekLaaeGydlsnpvDLkd 287 ekk++d++++ s+D+s++P+PvCsCtG++r+CYkWG+GGWqS+CCt++iS+yPLP+st+r+gaR+agrKmS+ga+ klL++La+eGydls+p+DLk+ AT2G35550.3 115 EKKNLDINIDISSFDTSGVPPPVCSCTGVSRVCYKWGMGGWQSSCCTISISTYPLPMSTTRPGARLAGRKMSNGAYVKLLARLADEGYDLSHPLDLKN 212 ************************************************************************************************** PP GAGA_bind 288 hWAkHGtnkfvtir 301 hWA+HGtnkfvti+ AT2G35550.3 213 HWARHGTNKFVTIK 226 *************8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM01226 | 1.3E-115 | 1 | 226 | IPR010409 | GAGA-binding transcriptional activator |
Pfam | PF06217 | 9.5E-70 | 65 | 226 | IPR010409 | GAGA-binding transcriptional activator |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding |
Plant Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PO Term | PO Category | PO Description | ||||
PO:0000084 | anatomy | plant sperm cell | ||||
PO:0000230 | anatomy | inflorescence meristem | ||||
PO:0000293 | anatomy | guard cell | ||||
PO:0009005 | anatomy | root | ||||
PO:0009009 | anatomy | plant embryo | ||||
PO:0009010 | anatomy | seed | ||||
PO:0009025 | anatomy | vascular leaf | ||||
PO:0009029 | anatomy | stamen | ||||
PO:0009030 | anatomy | carpel | ||||
PO:0009031 | anatomy | sepal | ||||
PO:0009032 | anatomy | petal | ||||
PO:0009046 | anatomy | flower | ||||
PO:0009047 | anatomy | stem | ||||
PO:0009052 | anatomy | flower pedicel | ||||
PO:0009066 | anatomy | anther | ||||
PO:0020100 | anatomy | hypocotyl | ||||
PO:0025022 | anatomy | collective leaf structure | ||||
PO:0025281 | anatomy | pollen | ||||
PO:0001017 | developmental stage | M germinated pollen stage | ||||
PO:0001054 | developmental stage | vascular leaf senescent stage | ||||
PO:0001078 | developmental stage | plant embryo cotyledonary stage | ||||
PO:0001081 | developmental stage | mature plant embryo stage | ||||
PO:0001185 | developmental stage | plant embryo globular stage | ||||
PO:0004507 | developmental stage | plant embryo bilateral stage | ||||
PO:0007115 | developmental stage | LP.04 four leaves visible stage | ||||
PO:0007123 | developmental stage | LP.06 six leaves visible stage | ||||
PO:0007611 | developmental stage | petal differentiation and expansion stage | ||||
PO:0007616 | developmental stage | flowering stage |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 226 aa Download sequence Send to blast |
MNSFPAQNLM LSATNANKDS GLRTSNAHWL HSCIAVPKTT GIDLSQEPPA EGVMVPQSHL 60 FPPPIRDSRN DTETVKQKSV NQSPSKALKP KPQRKKRSVS NKSKKTPSIP ETKREKKNLD 120 INIDISSFDT SGVPPPVCSC TGVSRVCYKW GMGGWQSSCC TISISTYPLP MSTTRPGARL 180 AGRKMSNGAY VKLLARLADE GYDLSHPLDL KNHWARHGTN KFVTIK |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
At.37658 | 0.0 | flower |
Expression -- Microarray ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | E-value | ||||
Genevisible | 257369_at | 0.0 | ||||
Expression Atlas | AT2G35550 | - | ||||
AtGenExpress | AT2G35550 | - | ||||
ATTED-II | AT2G35550 | - |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in seedlings, leaves and pistils. Detected in anthers, in pollen grains, in young rosette, in leaf vasculature, in the lateral and primary roots, in embryo sac, and in the whole ovule. {ECO:0000269|PubMed:14731261, ECO:0000269|PubMed:21435046}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional regulator that specifically binds to GA-rich elements (GAGA-repeats) present in regulatory sequences of genes involved in developmental processes. {ECO:0000269|PubMed:14731261}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | AT2G35550.3 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Phenotype -- Mutation ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | |||||
T-DNA Express | AT2G35550 |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AC005314 | 0.0 | AC005314.3 Arabidopsis thaliana chromosome 2 clone T32F12 map ve016, complete sequence. | |||
GenBank | AY102550 | 0.0 | AY102550.1 Arabidopsis thaliana hypothetical protein (At2g35550/T32F12.7) mRNA, complete cds. | |||
GenBank | AY116857 | 0.0 | AY116857.1 Arabidopsis thaliana hypothetical protein (At2g35550/T32F12.7) mRNA, complete cds, alternatively spliced. | |||
GenBank | AY380573 | 0.0 | AY380573.1 Arabidopsis thaliana basic pentacysteine 7 (BPC7) mRNA, complete cds. | |||
GenBank | BT026350 | 0.0 | BT026350.1 Arabidopsis thaliana At2g35550 gene, complete cds. | |||
GenBank | CP002685 | 0.0 | CP002685.1 Arabidopsis thaliana chromosome 2, complete sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_181098.2 | 1e-168 | basic pentacysteine 7 | ||||
Swissprot | O82286 | 1e-169 | BPC7_ARATH; Protein BASIC PENTACYSTEINE7 | ||||
TrEMBL | A0A178W000 | 1e-167 | A0A178W000_ARATH; BPC7 | ||||
STRING | AT2G35550.1 | 1e-168 | (Arabidopsis thaliana) |
Link Out ? help Back to Top | |
---|---|
Phytozome | AT2G35550.3 |
Entrez Gene | 818120 |
iHOP | AT2G35550 |
wikigenes | AT2G35550 |
Publications ? help Back to Top | |||
---|---|---|---|
|