PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | AT2G28510.1 | ||||||||
Common Name | DOF2.1, T17D12.7 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
|
||||||||
Family | Dof | ||||||||
Protein Properties | Length: 288aa MW: 31782 Da PI: 8.0376 | ||||||||
Description | Dof family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | zf-Dof | 121.7 | 2.5e-38 | 46 | 105 | 4 | 63 |
zf-Dof 4 kalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkksss 63 +a++cprC+s ntkfCyynnyslsqPryfCk+CrryWtkGG+lrnvPvGgg+r+nk+sss AT2G28510.1 46 EAQNCPRCESPNTKFCYYNNYSLSQPRYFCKSCRRYWTKGGTLRNVPVGGGCRRNKRSSS 105 5789****************************************************9875 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
ProDom | PD007478 | 7.0E-23 | 46 | 97 | IPR003851 | Zinc finger, Dof-type |
Pfam | PF02701 | 1.5E-32 | 47 | 102 | IPR003851 | Zinc finger, Dof-type |
PROSITE profile | PS50884 | 28.975 | 48 | 102 | IPR003851 | Zinc finger, Dof-type |
PROSITE pattern | PS01361 | 0 | 50 | 86 | IPR003851 | Zinc finger, Dof-type |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005730 | Cellular Component | nucleolus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046872 | Molecular Function | metal ion binding |
Plant Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PO Term | PO Category | PO Description | ||||
PO:0000013 | anatomy | cauline leaf | ||||
PO:0000037 | anatomy | shoot apex | ||||
PO:0000230 | anatomy | inflorescence meristem | ||||
PO:0000293 | anatomy | guard cell | ||||
PO:0008019 | anatomy | leaf lamina base | ||||
PO:0009005 | anatomy | root | ||||
PO:0009006 | anatomy | shoot system | ||||
PO:0009009 | anatomy | plant embryo | ||||
PO:0009010 | anatomy | seed | ||||
PO:0009025 | anatomy | vascular leaf | ||||
PO:0009029 | anatomy | stamen | ||||
PO:0009030 | anatomy | carpel | ||||
PO:0009031 | anatomy | sepal | ||||
PO:0009032 | anatomy | petal | ||||
PO:0009046 | anatomy | flower | ||||
PO:0009047 | anatomy | stem | ||||
PO:0009052 | anatomy | flower pedicel | ||||
PO:0020030 | anatomy | cotyledon | ||||
PO:0020038 | anatomy | petiole | ||||
PO:0020100 | anatomy | hypocotyl | ||||
PO:0020137 | anatomy | leaf apex | ||||
PO:0025022 | anatomy | collective leaf structure | ||||
PO:0025281 | anatomy | pollen | ||||
PO:0001054 | developmental stage | vascular leaf senescent stage | ||||
PO:0001078 | developmental stage | plant embryo cotyledonary stage | ||||
PO:0001081 | developmental stage | mature plant embryo stage | ||||
PO:0001185 | developmental stage | plant embryo globular stage | ||||
PO:0004507 | developmental stage | plant embryo bilateral stage | ||||
PO:0007064 | developmental stage | LP.12 twelve leaves visible stage | ||||
PO:0007095 | developmental stage | LP.08 eight leaves visible stage | ||||
PO:0007098 | developmental stage | LP.02 two leaves visible stage | ||||
PO:0007103 | developmental stage | LP.10 ten leaves visible stage | ||||
PO:0007115 | developmental stage | LP.04 four leaves visible stage | ||||
PO:0007123 | developmental stage | LP.06 six leaves visible stage | ||||
PO:0007611 | developmental stage | petal differentiation and expansion stage | ||||
PO:0007616 | developmental stage | flowering stage |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 288 aa Download sequence Send to blast |
MDPEQEISNE TLETILVSST KGSNNNNKKM EEEMKKKVSR GELGGEAQNC PRCESPNTKF 60 CYYNNYSLSQ PRYFCKSCRR YWTKGGTLRN VPVGGGCRRN KRSSSSAFSK NNNNKSINFH 120 TDPLQNPLIT GMPPSSFGYD HSIDLNLAFA TLQKHHLSSQ ATTPSFGFGG DLSIYGNSTN 180 DVGIFGGQNG TYNNSLCYGF MSGNGNNNQN EIKMASTLGM SLEGNERKQE NVNNNNNNSE 240 NPSKVFWGFP WQMTGDSAGV VPEIDPGRES WNGMVSSWNN GLLNTPLV |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
At.28359 | 0.0 | root| silique |
Expression -- Microarray ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | E-value | ||||
GEO | 17979382 | 0.0 | ||||
Genevisible | 264056_at | 0.0 | ||||
Expression Atlas | AT2G28510 | - | ||||
AtGenExpress | AT2G28510 | - | ||||
ATTED-II | AT2G28510 | - |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: Expressed at preprocambial stages first in wide domains, and later confined to sites of vein development. {ECO:0000269|PubMed:20563990}. | |||||
Uniprot | TISSUE SPECIFICITY: Accumulates in the stele. {ECO:0000269|PubMed:20563990}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence. {ECO:0000250}. |
Function -- GeneRIF ? help Back to Top | ||||||
---|---|---|---|---|---|---|
|
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | AT2G28510.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Phenotype -- Mutation ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | |||||
T-DNA Express | AT2G28510 |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AY070421 | 0.0 | AY070421.1 Arabidopsis thaliana putative DOF zinc finger protein (At2g28510) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_565673.1 | 0.0 | Dof-type zinc finger DNA-binding family protein | ||||
Swissprot | Q8LE43 | 0.0 | DOF21_ARATH; Dof zinc finger protein DOF2.1 | ||||
TrEMBL | A0A178VVJ9 | 0.0 | A0A178VVJ9_ARATH; Uncharacterized protein | ||||
STRING | AT2G28510.1 | 0.0 | (Arabidopsis thaliana) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM6960 | 27 | 43 | Representative plant | OGRP38 | 17 | 445 |
Link Out ? help Back to Top | |
---|---|
Phytozome | AT2G28510.1 |
Entrez Gene | 817399 |
iHOP | AT2G28510 |
wikigenes | AT2G28510 |