PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | AT2G24430.2 | ||||||||
Common Name | ANAC038, ANAC039, NAC038 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 316aa MW: 35841.1 Da PI: 8.4293 | ||||||||
Description | NAC domain containing protein 38 | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 176.1 | 9.8e-55 | 16 | 143 | 1 | 128 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk.kg 97 lppGfrFhPtdeel+++yL +k+++++++ ++i++vd++k+ePw+Lp+k+k + kewyfFs rd+ky+tg r+nrat++gyWk+tgkdke++++ ++ AT2G24430.2 16 LPPGFRFHPTDEELISYYLVNKIADQNFTG-KAIADVDLNKSEPWELPEKAKMGGKEWYFFSLRDRKYPTGVRTNRATNTGYWKTTGKDKEIFNStTS 112 79*************************999.88***************99999****************************************98788 PP NAM 98 elvglkktLvfykgrapkgektdWvmheyrl 128 elvg+kktLvfy+grap+gekt Wvmheyrl AT2G24430.2 113 ELVGMKKTLVFYRGRAPRGEKTCWVMHEYRL 143 89***************************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 2.48E-63 | 12 | 165 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 60.917 | 16 | 165 | IPR003441 | NAC domain |
Pfam | PF02365 | 1.3E-28 | 17 | 143 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0007275 | Biological Process | multicellular organism development | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding |
Plant Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PO Term | PO Category | PO Description | ||||
PO:0009005 | anatomy | root | ||||
PO:0009025 | anatomy | vascular leaf | ||||
PO:0009047 | anatomy | stem | ||||
PO:0020100 | anatomy | hypocotyl | ||||
PO:0007098 | developmental stage | LP.02 two leaves visible stage | ||||
PO:0007115 | developmental stage | LP.04 four leaves visible stage |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 316 aa Download sequence Send to blast |
MEQGDHQQHK KEEEALPPGF RFHPTDEELI SYYLVNKIAD QNFTGKAIAD VDLNKSEPWE 60 LPEKAKMGGK EWYFFSLRDR KYPTGVRTNR ATNTGYWKTT GKDKEIFNST TSELVGMKKT 120 LVFYRGRAPR GEKTCWVMHE YRLHSKSSYR TSKQDEWVVC RVFKKTEATK KYISTSSSST 180 SHHHNNHTRA SILSTNNNNP NYSSDLLQLP PHLQPHPSLN INQSLMANAV HLAELSRVFR 240 ASTSTTMDSS HQQLMNYTHM PVSGLNLNLG GALVQPPPVV SLEDVAAVSA SYNGENGFGN 300 VEMSQCMDLD GYWPSY |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ut4_A | 1e-57 | 15 | 171 | 16 | 171 | NO APICAL MERISTEM PROTEIN |
1ut4_B | 1e-57 | 15 | 171 | 16 | 171 | NO APICAL MERISTEM PROTEIN |
1ut7_A | 1e-57 | 15 | 171 | 16 | 171 | NO APICAL MERISTEM PROTEIN |
1ut7_B | 1e-57 | 15 | 171 | 16 | 171 | NO APICAL MERISTEM PROTEIN |
3swm_A | 1e-57 | 15 | 171 | 19 | 174 | NAC domain-containing protein 19 |
3swm_B | 1e-57 | 15 | 171 | 19 | 174 | NAC domain-containing protein 19 |
3swm_C | 1e-57 | 15 | 171 | 19 | 174 | NAC domain-containing protein 19 |
3swm_D | 1e-57 | 15 | 171 | 19 | 174 | NAC domain-containing protein 19 |
3swp_A | 1e-57 | 15 | 171 | 19 | 174 | NAC domain-containing protein 19 |
3swp_B | 1e-57 | 15 | 171 | 19 | 174 | NAC domain-containing protein 19 |
3swp_C | 1e-57 | 15 | 171 | 19 | 174 | NAC domain-containing protein 19 |
3swp_D | 1e-57 | 15 | 171 | 19 | 174 | NAC domain-containing protein 19 |
4dul_A | 1e-57 | 15 | 171 | 16 | 171 | NAC domain-containing protein 19 |
4dul_B | 1e-57 | 15 | 171 | 16 | 171 | NAC domain-containing protein 19 |
Search in ModeBase |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
At.39159 | 0.0 | root| seed |
Expression -- Microarray ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | E-value | ||||
Genevisible | 265685_at | 0.0 | ||||
Expression Atlas | AT2G24430 | - | ||||
AtGenExpress | AT2G24430 | - | ||||
ATTED-II | AT2G24430 | - |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: First observed in young embryonic SAM. Later confined to the boundaries between cotyledon primordia and the SAM. In mature embryos, localized around first leaves primordia. Only weakly present in vegetative SAM. In inflorescence, observed at the boundaries between floral organ primordia. In callus, expressed during transition to shoot development, with a progressive restriction to specific areas corresponding to future shoot apex. {ECO:0000269|PubMed:11245578, ECO:0000269|PubMed:12492830}. | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in inflorescence stems, rosette leaves, aerial parts of seedlings, flowers, floral buds and roots. {ECO:0000269|PubMed:11245578}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator of STM and KNAT6. Involved in molecular mechanisms regulating shoot apical meristem (SAM) formation during embryogenesis and organ separation. Required for the fusion of septa of gynoecia along the length of the ovaries. Activates the shoot formation in callus in a STM-dependent manner. Seems to act as an inhibitor of cell division. {ECO:0000269|PubMed:10079219, ECO:0000269|PubMed:10750709, ECO:0000269|PubMed:11245578, ECO:0000269|PubMed:12163400, ECO:0000269|PubMed:12492830, ECO:0000269|PubMed:12610213, ECO:0000269|PubMed:12787253, ECO:0000269|PubMed:14617069, ECO:0000269|PubMed:15202996, ECO:0000269|PubMed:15294871, ECO:0000269|PubMed:15500463, ECO:0000269|PubMed:15723790, ECO:0000269|PubMed:16798887, ECO:0000269|PubMed:17122068, ECO:0000269|PubMed:17287247, ECO:0000269|PubMed:9212461}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00277 | DAP | 27203113 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | AT2G24430.2 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By BRM, at the chromatin level, and conferring a very specific spatial expression pattern. Directly induced by ESR2 in response to cytokinins. Precise spatial regulation by post-transcriptional repression directed by the microRNA miR164. {ECO:0000269|PubMed:15202996, ECO:0000269|PubMed:15294871, ECO:0000269|PubMed:15723790, ECO:0000269|PubMed:16854978, ECO:0000269|PubMed:17056621, ECO:0000269|PubMed:17287247}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Phenotype -- Mutation ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | |||||
T-DNA Express | AT2G24430 |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AC006403 | 0.0 | AC006403.4 Arabidopsis thaliana chromosome 2 clone T28I24 map mi238, complete sequence. | |||
GenBank | CP002685 | 0.0 | CP002685.1 Arabidopsis thaliana chromosome 2, complete sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_180019.1 | 0.0 | NAC domain containing protein 38 | ||||
Refseq | NP_850054.1 | 0.0 | NAC domain containing protein 38 | ||||
Swissprot | Q9FRV4 | 3e-80 | NAC54_ARATH; Protein CUP-SHAPED COTYLEDON 1 | ||||
TrEMBL | Q9ZQ25 | 0.0 | Q9ZQ25_ARATH; NAC domain containing protein 38 | ||||
STRING | AT2G24430.2 | 0.0 | (Arabidopsis thaliana) |
Link Out ? help Back to Top | |
---|---|
Phytozome | AT2G24430.2 |
Entrez Gene | 816979 |
iHOP | AT2G24430 |
wikigenes | AT2G24430 |