PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

AT2G22430.1

Common Name

ATHB6, ATHB-6, F14M13.17, HB6

Organism

Arabidopsis thaliana

Taxonomic ID

3702

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis

Family

HD-ZIP

Protein Properties

Length: 311aa MW: 35017.6 Da PI: 4.4705

Description

homeobox protein 6

Gene Model

Gene Model ID	Type	Source	Coding Sequence
AT2G22430.1	genome	TAIR	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Homeobox	57.3	2.6e-18	62	115	3	56
--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS Homeobox 3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 k+++++ +q+++Le+ Fe ++++ e++ +LA++lgL+ rqV vWFqNrRa++k AT2G22430.1 62 KKRRLSINQVKALEKNFELENKLEPERKVKLAQELGLQPRQVAVWFQNRRARWK 115 5568999**********************************************9 PP
2	HD-ZIP_I/II	128.9	2.1e-41	61	153	1	93
HD-ZIP_I/II 1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelke 93 ekkrrls +qvk+LE++Fe e+kLeperKv+la+eLglqprqvavWFqnrRAR+ktkqlEkdy +Lk++yd+l+++ ++L++++e+L +e+++ AT2G22430.1 61 EKKRRLSINQVKALEKNFELENKLEPERKVKLAQELGLQPRQVAVWFQNRRARWKTKQLEKDYGVLKTQYDSLRHNFDSLRRDNESLLQEISK 153 69*************************************************************************************999976 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS50071	16.908	57	117	IPR001356	Homeobox domain
SuperFamily	SSF46689	2.01E-18	59	119	IPR009057	Homeodomain-like
SMART	SM00389	3.4E-17	60	121	IPR001356	Homeobox domain
Pfam	PF00046	1.4E-15	62	115	IPR001356	Homeobox domain
CDD	cd00086	2.42E-15	62	118	No hit	No description
Gene3D	G3DSA:1.10.10.60	3.2E-19	64	124	IPR009057	Homeodomain-like
PRINTS	PR00031	8.7E-6	88	97	IPR000047	Helix-turn-helix motif
PROSITE pattern	PS00027	0	92	115	IPR017970	Homeobox, conserved site
PRINTS	PR00031	8.7E-6	97	113	IPR000047	Helix-turn-helix motif
Pfam	PF02183	5.4E-17	117	158	IPR003106	Leucine zipper, homeobox-associated

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0009414	Biological Process	response to water deprivation
GO:0009788	Biological Process	negative regulation of abscisic acid-activated signaling pathway
GO:0045893	Biological Process	positive regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0005515	Molecular Function	protein binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Plant Ontology ? help Back to Top
PO Term	PO Category	PO Description
PO:0000013	anatomy	cauline leaf
PO:0000017	anatomy	vascular leaf primordium
PO:0000037	anatomy	shoot apex
PO:0000230	anatomy	inflorescence meristem
PO:0000293	anatomy	guard cell
PO:0008019	anatomy	leaf lamina base
PO:0009001	anatomy	fruit
PO:0009005	anatomy	root
PO:0009006	anatomy	shoot system
PO:0009009	anatomy	plant embryo
PO:0009010	anatomy	seed
PO:0009025	anatomy	vascular leaf
PO:0009029	anatomy	stamen
PO:0009030	anatomy	carpel
PO:0009031	anatomy	sepal
PO:0009032	anatomy	petal
PO:0009046	anatomy	flower
PO:0009047	anatomy	stem
PO:0009052	anatomy	flower pedicel
PO:0020030	anatomy	cotyledon
PO:0020038	anatomy	petiole
PO:0020100	anatomy	hypocotyl
PO:0020121	anatomy	lateral root
PO:0020127	anatomy	primary root
PO:0020137	anatomy	leaf apex
PO:0025022	anatomy	collective leaf structure
PO:0025281	anatomy	pollen
PO:0001054	developmental stage	vascular leaf senescent stage
PO:0001078	developmental stage	plant embryo cotyledonary stage
PO:0001081	developmental stage	mature plant embryo stage
PO:0001185	developmental stage	plant embryo globular stage
PO:0004507	developmental stage	plant embryo bilateral stage
PO:0007064	developmental stage	LP.12 twelve leaves visible stage
PO:0007095	developmental stage	LP.08 eight leaves visible stage
PO:0007098	developmental stage	LP.02 two leaves visible stage
PO:0007103	developmental stage	LP.10 ten leaves visible stage
PO:0007115	developmental stage	LP.04 four leaves visible stage
PO:0007123	developmental stage	LP.06 six leaves visible stage
PO:0007611	developmental stage	petal differentiation and expansion stage
PO:0007616	developmental stage	flowering stage

Sequence ? help Back to Top
Protein Sequence Length: 311 aa Download sequence Send to blast
MMKRLSSSDS VGGLISLCPT TSTDEQSPRR YGGREFQSML EGYEEEEEAI VEERGHVGLS 60 EKKRRLSINQ VKALEKNFEL ENKLEPERKV KLAQELGLQP RQVAVWFQNR RARWKTKQLE 120 KDYGVLKTQY DSLRHNFDSL RRDNESLLQE ISKLKTKLNG GGGEEEEEEN NAAVTTESDI 180 SVKEEEVSLP EKITEAPSSP PQFLEHSDGL NYRSFTDLRD LLPLKAAASS FAAAAGSSDS 240 SDSSALLNEE SSSNVTVAAP VTVPGGNFFQ FVKMEQTEDH EDFLSGEEAC EFFSDEQPPS 300 LHWYSTVDHW N

Nucleic Localization Signal ? help Back to Top

No.	Start	End	Sequence
1	109	117	RRARWKTKQ

Expression -- UniGene ? help Back to Top
UniGene ID	E-value	Expressed in
At.25257	0.0	bud\| cell culture\| floral meristem\| flower\| leaf\| root

Expression -- Microarray ? help Back to Top
Source	ID	E-value
GEO	30681708	0.0
Genevisible	264006_at	0.0
Expression Atlas	AT2G22430	-
AtGenExpress	AT2G22430	-
ATTED-II	AT2G22430	-

Expression -- Description ? help Back to Top
Source	Description
Uniprot	TISSUE SPECIFICITY: Widely expressed. {ECO:0000269\|PubMed:10527431, ECO:0000269\|PubMed:16055682}.

Functional Description ? help Back to Top
Source	Description
TAIR	Encodes a homeodomain leucine zipper class I (HD-Zip I) protein that is a target of the protein phosphatase ABI1 and regulates hormone responses in Arabidopsis.
UniProt	Transcription activator that may act as growth regulators in response to water deficit. Interacts with the core sequence 5'-CAATTATTA-3' of promoters in response to ABA and in an ABI1-dependent manner. Involved in the negative regulation of the ABA signaling pathway. {ECO:0000269\|PubMed:10527431, ECO:0000269\|PubMed:12065416}.

Function -- GeneRIF ? help Back to Top
MATH-BTB proteins directly interact with and target for proteasomal degradation the class I homeobox-leucine zipper (HD-ZIP) transcription factor ATHB6, which was previously identified as a negative regulator of abscisic acid responses. [PMID: 22172674]

Binding Motif ? help Back to Top
Motif ID	Method	Source	Motif file
MP00271	DAP	27203113	Download

Cis-element ? help Back to Top
Source	Link
PlantRegMap	AT2G22430.1

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By water deficit, by abscisic acid (ABA) and by salt stress. Self expression regulation. {ECO:0000269\|PubMed:10527431, ECO:0000269\|PubMed:12065416, ECO:0000269\|PubMed:16055682}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	Retrieve

Regulation -- Hormone ? help Back to Top
Source	Hormone
AHD	abscisic acid

Interaction ? help Back to Top
Source	Intact With
BioGRID	AT5G65310, AT1G10585

Phenotype -- Mutation ? help Back to Top
Source	ID
T-DNA Express	AT2G22430

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AY060569	0.0	AY060569.1 Arabidopsis thaliana At2g22430/F14M13.17 mRNA, complete cds.
GenBank	AY063819	0.0	AY063819.1 Arabidopsis thaliana putative homeodomain transcription factor ATHB-6 (At2g22430) mRNA, complete cds.
GenBank	AY094457	0.0	AY094457.1 Arabidopsis thaliana At2g22430/F14M13.17 mRNA, complete cds.
GenBank	AY122903	0.0	AY122903.1 Arabidopsis thaliana At2g22430/F14M13.17 mRNA, complete cds.
GenBank	X67034	0.0	X67034.1 A.thaliana mRNA Athb-6.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	NP_565536.1	0.0	homeobox protein 6
Swissprot	P46668	0.0	ATHB6_ARATH; Homeobox-leucine zipper protein ATHB-6
TrEMBL	A0A178VSN9	0.0	A0A178VSN9_ARATH; HB6
STRING	AT2G22430.1	0.0	(Arabidopsis thaliana)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM545	28	143
Representative plant	OGRP129	16	189

Link Out ? help Back to Top
Phytozome	AT2G22430.1
Entrez Gene	816775
iHOP	AT2G22430
wikigenes	AT2G22430

Publications ? help Back to Top
Söderman E,Hjellström M,Fahleson J,Engström P The HD-Zip gene ATHB6 in Arabidopsis is expressed in developing leaves, roots and carpels and up-regulated by water deficit conditions. Plant Mol. Biol., 1999. 40(6): p. 1073-83 [PMID:10527431] Riechmann JL, et al. Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes. Science, 2000. 290(5499): p. 2105-10 [PMID:11118137] Johannesson H,Wang Y,Engström P DNA-binding and dimerization preferences of Arabidopsis homeodomain-leucine zipper transcription factors in vitro. Plant Mol. Biol., 2001. 45(1): p. 63-73 [PMID:11247607] Himmelbach A,Hoffmann T,Leube M,Höhener B,Grill E Homeodomain protein ATHB6 is a target of the protein phosphatase ABI1 and regulates hormone responses in Arabidopsis. EMBO J., 2002. 21(12): p. 3029-38 [PMID:12065416] Bray EA Classification of genes differentially expressed during water-deficit stress in Arabidopsis thaliana: an analysis using microarray and differential expression data. Ann. Bot., 2002. 89 Spec No: p. 803-11 [PMID:12102506] Gutierrez RA,Ewing RM,Cherry JM,Green PJ Identification of unstable transcripts in Arabidopsis by cDNA microarray analysis: rapid decay is associated with a group of touch- and specific clock-controlled genes. Proc. Natl. Acad. Sci. U.S.A., 2002. 99(17): p. 11513-8 [PMID:12167669] Menges M,Hennig L,Gruissem W,Murray JA Cell cycle-regulated gene expression in Arabidopsis. J. Biol. Chem., 2002. 277(44): p. 41987-2002 [PMID:12169696] Vlieghe K, et al. Microarray analysis of E2Fa-DPa-overexpressing plants uncovers a cross-talking genetic network between DNA replication and nitrogen assimilation. J. Cell. Sci., 2003. 116(Pt 20): p. 4249-59 [PMID:12953064] Chen IP,Haehnel U,Altschmied L,Schubert I,Puchta H The transcriptional response of Arabidopsis to genotoxic stress - a high-density colony array study (HDCA). Plant J., 2003. 35(6): p. 771-86 [PMID:12969430] Oh S,Park S,Han KH Transcriptional regulation of secondary growth in Arabidopsis thaliana. J. Exp. Bot., 2003. 54(393): p. 2709-22 [PMID:14585825] Yamada K, et al. Empirical analysis of transcriptional activity in the Arabidopsis genome. Science, 2003. 302(5646): p. 842-6 [PMID:14593172] Hu W,Wang Y,Bowers C,Ma H Isolation, sequence analysis, and expression studies of florally expressed cDNAs in Arabidopsis. Plant Mol. Biol., 2003. 53(4): p. 545-63 [PMID:15010618] Ko JH,Han KH,Park S,Yang J Plant body weight-induced secondary growth in Arabidopsis and its transcription phenotype revealed by whole-transcriptome profiling. Plant Physiol., 2004. 135(2): p. 1069-83 [PMID:15194820] Gong W, et al. Genome-wide ORFeome cloning and analysis of Arabidopsis transcription factor genes. Plant Physiol., 2004. 135(2): p. 773-82 [PMID:15208423] Kang JG,Pyo YJ,Cho JW,Cho MH Comparative proteome analysis of differentially expressed proteins induced by K+ deficiency in Arabidopsis thaliana. Proteomics, 2004. 4(11): p. 3549-59 [PMID:15449379] Hampton CR, et al. Cesium toxicity in Arabidopsis. Plant Physiol., 2004. 136(3): p. 3824-37 [PMID:15489280] Lu Y,Zhu J,Liu P A two-step strategy for detecting differential gene expression in cDNA microarray data. Curr. Genet., 2005. 47(2): p. 121-31 [PMID:15688252] Nagata T,Yamada H,Du Z,Todoriki S,Kikuchi S Microarray analysis of genes that respond to gamma-irradiation in Arabidopsis. J. Agric. Food Chem., 2005. 53(4): p. 1022-30 [PMID:15713015] Henriksson E, et al. Homeodomain leucine zipper class I genes in Arabidopsis. Expression patterns and phylogenetic relationships. Plant Physiol., 2005. 139(1): p. 509-18 [PMID:16055682] Lidder P,Guti Circadian control of messenger RNA stability. Association with a sequence-specific messenger RNA decay pathway. Plant Physiol., 2005. 138(4): p. 2374-85 [PMID:16055688] Vergnolle C, et al. The cold-induced early activation of phospholipase C and D pathways determines the response of two distinct clusters of genes in Arabidopsis cell suspensions. Plant Physiol., 2005. 139(3): p. 1217-33 [PMID:16258011] Deng X, et al. A homeodomain leucine zipper gene from Craterostigma plantagineum regulates abscisic acid responsive gene expression and physiological responses. Plant Mol. Biol., 2006. 61(3): p. 469-89 [PMID:16830180] Nemhauser JL,Hong F,Chory J Different plant hormones regulate similar processes through largely nonoverlapping transcriptional responses. Cell, 2006. 126(3): p. 467-75 [PMID:16901781] Fleury D, et al. The Arabidopsis thaliana homolog of yeast BRE1 has a function in cell cycle regulation during early leaf and root growth. Plant Cell, 2007. 19(2): p. 417-32 [PMID:17329565] Willems G, et al. The genetic basis of zinc tolerance in the metallophyte Arabidopsis halleri ssp. halleri (Brassicaceae): an analysis of quantitative trait loci. Genetics, 2007. 176(1): p. 659-74 [PMID:17409091] Soitamo AJ,Piippo M,Allahverdiyeva Y,Battchikova N,Aro EM Light has a specific role in modulating Arabidopsis gene expression at low temperature. BMC Plant Biol., 2008. 8: p. 13 [PMID:18230142] Shin R,Jez JM,Basra A,Zhang B,Schachtman DP 14-3-3 proteins fine-tune plant nutrient metabolism. FEBS Lett., 2011. 585(1): p. 143-7 [PMID:21094157] Lechner E, et al. MATH/BTB CRL3 receptors target the homeodomain-leucine zipper ATHB6 to modulate abscisic acid signaling. Dev. Cell, 2011. 21(6): p. 1116-28 [PMID:22172674] Kouno T,Ezaki B Multiple regulation of Arabidopsis AtGST11 gene expression by four transcription factors under abiotic stresses. Physiol Plant, 2013. 148(1): p. 97-104 [PMID:23009097] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Lumba S, et al. A mesoscale abscisic acid hormone interactome reveals a dynamic signaling landscape in Arabidopsis. Dev. Cell, 2014. 29(3): p. 360-72 [PMID:24823379] Song L, et al. A transcription factor hierarchy defines an environmental stress response network. Science, 2017. [PMID:27811239] S Expression patterns of novel genes encoding homeodomain leucine-zipper proteins in Arabidopsis thaliana. Plant Mol. Biol., 1994. 26(1): p. 145-54 [PMID:7948864]