PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | AT2G21240.1 | ||||||||
Common Name | ATBPC4, BBR, BPC4, F7O24.4 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
|
||||||||
Family | BBR-BPC | ||||||||
Protein Properties | Length: 296aa MW: 33306.8 Da PI: 9.4974 | ||||||||
Description | basic pentacysteine 4 | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | GAGA_bind | 354.6 | 2.2e-108 | 1 | 296 | 1 | 301 |
GAGA_bind 1 mdddgsre..rnkg.yye................paaslkenlglqlmssiaerdakirernlalsekkaavaerdmaflqrdkalaernkalverdn 79 m++ g+++ r+k+ y++ ++++l +++++ms++aerda+++ern+a+s+kk+ava+rd+a++qrdkal+er+kal+erdn AT2G21240.1 1 MENGGQYDnaRFKPdYFKgaqsmwnmipqhqikeQHNALV--MNKKIMSILAERDAAVHERNQAVSAKKEAVAARDEALQQRDKALSERDKALIERDN 96 9999999999****9999*********9888765446666..99****************************************************** PP GAGA_bind 80 kllalllvenslasalpvgvqvlsgtksidslqqlsepqledsavelreeeklealpieeaaeeakekkkkkkrqrakkpkekkak..kkkkkseksk 175 +++al+++ensl++a lsg k++d +d+++++ e +kle++p+++ ++e++++k ++kr +ke+k+ k+kk +e+ + AT2G21240.1 97 AYAALQHHENSLNFA-------LSGGKCVD----------GDDCFGIGEPHKLEVFPLSTIPPEVTNTKVVNKR-----KKENKQGlsKVKKVGEDLN 172 **********96655.......59*****9..........799**************************99943.....333444333788889999* PP GAGA_bind 176 kkvkkesaderskaekksidlvlngvslDestlPvPvCsCtGalrqCYkWGnGGWqSaCCtttiSvyPLPvstkrrgaRiagrKmSqgafkklLekLa 273 ++v +++ ++s+++++s+d++ln v++De+t+PvP+CsCtG++rqCYkWGnGGWqS+CCttt+S+yPLP+++++r++R++grKmS+++f++lL++L+ AT2G21240.1 173 RRVPAPG--KKSRTDWDSQDVGLNLVTFDETTMPVPMCSCTGSTRQCYKWGNGGWQSSCCTTTLSQYPLPQMPNKRHSRMGGRKMSGNVFSRLLSRLS 268 *******..57*************************************************************************************** PP GAGA_bind 274 aeGydlsnpvDLkdhWAkHGtnkfvtir 301 aeGydls+pvDLkd+WA+HGtn+++ti+ AT2G21240.1 269 AEGYDLSCPVDLKDYWARHGTNRYITIK 296 ***************************8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF06217 | 3.2E-94 | 1 | 296 | IPR010409 | GAGA-binding transcriptional activator |
SMART | SM01226 | 2.3E-172 | 1 | 296 | IPR010409 | GAGA-binding transcriptional activator |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0009723 | Biological Process | response to ethylene | ||||
GO:0050793 | Biological Process | regulation of developmental process | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0042803 | Molecular Function | protein homodimerization activity |
Plant Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PO Term | PO Category | PO Description | ||||
PO:0000013 | anatomy | cauline leaf | ||||
PO:0000037 | anatomy | shoot apex | ||||
PO:0000084 | anatomy | plant sperm cell | ||||
PO:0000230 | anatomy | inflorescence meristem | ||||
PO:0000293 | anatomy | guard cell | ||||
PO:0008019 | anatomy | leaf lamina base | ||||
PO:0009005 | anatomy | root | ||||
PO:0009006 | anatomy | shoot system | ||||
PO:0009009 | anatomy | plant embryo | ||||
PO:0009010 | anatomy | seed | ||||
PO:0009025 | anatomy | vascular leaf | ||||
PO:0009029 | anatomy | stamen | ||||
PO:0009030 | anatomy | carpel | ||||
PO:0009031 | anatomy | sepal | ||||
PO:0009032 | anatomy | petal | ||||
PO:0009046 | anatomy | flower | ||||
PO:0009047 | anatomy | stem | ||||
PO:0009052 | anatomy | flower pedicel | ||||
PO:0020030 | anatomy | cotyledon | ||||
PO:0020038 | anatomy | petiole | ||||
PO:0020100 | anatomy | hypocotyl | ||||
PO:0020137 | anatomy | leaf apex | ||||
PO:0025022 | anatomy | collective leaf structure | ||||
PO:0025281 | anatomy | pollen | ||||
PO:0001054 | developmental stage | vascular leaf senescent stage | ||||
PO:0001078 | developmental stage | plant embryo cotyledonary stage | ||||
PO:0001081 | developmental stage | mature plant embryo stage | ||||
PO:0001185 | developmental stage | plant embryo globular stage | ||||
PO:0004507 | developmental stage | plant embryo bilateral stage | ||||
PO:0007064 | developmental stage | LP.12 twelve leaves visible stage | ||||
PO:0007095 | developmental stage | LP.08 eight leaves visible stage | ||||
PO:0007098 | developmental stage | LP.02 two leaves visible stage | ||||
PO:0007103 | developmental stage | LP.10 ten leaves visible stage | ||||
PO:0007115 | developmental stage | LP.04 four leaves visible stage | ||||
PO:0007123 | developmental stage | LP.06 six leaves visible stage | ||||
PO:0007611 | developmental stage | petal differentiation and expansion stage | ||||
PO:0007616 | developmental stage | flowering stage |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 296 aa Download sequence Send to blast |
MENGGQYDNA RFKPDYFKGA QSMWNMIPQH QIKEQHNALV MNKKIMSILA ERDAAVHERN 60 QAVSAKKEAV AARDEALQQR DKALSERDKA LIERDNAYAA LQHHENSLNF ALSGGKCVDG 120 DDCFGIGEPH KLEVFPLSTI PPEVTNTKVV NKRKKENKQG LSKVKKVGED LNRRVPAPGK 180 KSRTDWDSQD VGLNLVTFDE TTMPVPMCSC TGSTRQCYKW GNGGWQSSCC TTTLSQYPLP 240 QMPNKRHSRM GGRKMSGNVF SRLLSRLSAE GYDLSCPVDL KDYWARHGTN RYITIK |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
At.39586 | 0.0 | flower| leaf| seed |
Expression -- Microarray ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | E-value | ||||
GEO | 186501998 | 0.0 | ||||
Genevisible | 263413_at | 0.0 | ||||
Expression Atlas | AT2G21240 | - | ||||
AtGenExpress | AT2G21240 | - | ||||
ATTED-II | AT2G21240 | - |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in seedlings, leaves and pistils. Detected in the base of flowers and tips of carpels, in sepal and petal vasculature, in anthers, in young rosette, in the lateral and primary roots, and in the whole ovule. {ECO:0000269|PubMed:14731261, ECO:0000269|PubMed:21435046}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional regulator that specifically binds to GA-rich elements (GAGA-repeats) present in regulatory sequences of genes involved in developmental processes. {ECO:0000269|PubMed:14731261}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | AT2G21240.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Interaction ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Intact With | |||||
BioGRID | AT2G21240, AT5G42520 |
Phenotype -- Mutation ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | |||||
T-DNA Express | AT2G21240 |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AK229090 | 0.0 | AK229090.1 Arabidopsis thaliana mRNA for hypothetical protein, complete cds, clone: RAFL16-37-J01. | |||
GenBank | AK317165 | 0.0 | AK317165.1 Arabidopsis thaliana AT2G21240 mRNA, complete cds, clone: RAFL21-54-A06. | |||
GenBank | AY084554 | 0.0 | AY084554.1 Arabidopsis thaliana clone 111536 mRNA, complete sequence. | |||
GenBank | BT026109 | 0.0 | BT026109.1 Arabidopsis thaliana At2g21240 mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_565503.1 | 0.0 | basic pentacysteine 4 | ||||
Refseq | NP_850012.1 | 0.0 | basic pentacysteine 4 | ||||
Swissprot | Q8S8C6 | 0.0 | BPC4_ARATH; Protein BASIC PENTACYSTEINE4 | ||||
TrEMBL | A0A178VSW9 | 0.0 | A0A178VSW9_ARATH; BPC4 | ||||
STRING | AT2G21240.1 | 0.0 | (Arabidopsis thaliana) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM4090 | 26 | 59 | Representative plant | OGRP2841 | 13 | 31 |
Link Out ? help Back to Top | |
---|---|
Phytozome | AT2G21240.1 |
Entrez Gene | 816663 |
iHOP | AT2G21240 |
wikigenes | AT2G21240 |
Publications ? help Back to Top | |||
---|---|---|---|
|