PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | AT2G06200.1 | ||||||||
Common Name | AtGRF6, F5K7.4, GRF6 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
|
||||||||
Family | GRF | ||||||||
Protein Properties | Length: 244aa MW: 28210.6 Da PI: 8.7959 | ||||||||
Description | growth-regulating factor 6 | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | WRC | 76.5 | 2.7e-24 | 80 | 124 | 1 | 45 |
WRC 1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 daepgrCrRtDGKkWRCs+++++++k+CErH+hrg++rs+++k + AT2G06200.1 80 DAEPGRCRRTDGKKWRCSKEAYPDSKYCERHMHRGKNRSSSRKPP 124 79**************************************99875 PP | |||||||
2 | QLQ | 59.6 | 9.1e-21 | 6 | 41 | 2 | 37 |
QLQ 2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37 +FT +Q+++L++Q+l++KyLaan+PvPp+Ll+ i++ AT2G06200.1 6 PFTESQWEELENQALVFKYLAANMPVPPHLLFLIKR 41 8******************************99975 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00951 | 3.2E-14 | 5 | 41 | IPR014978 | Glutamine-Leucine-Glutamine, QLQ |
Pfam | PF08880 | 1.9E-15 | 6 | 39 | IPR014978 | Glutamine-Leucine-Glutamine, QLQ |
PROSITE profile | PS51666 | 22.628 | 6 | 41 | IPR014978 | Glutamine-Leucine-Glutamine, QLQ |
PROSITE profile | PS51667 | 24.005 | 80 | 124 | IPR014977 | WRC domain |
Pfam | PF08879 | 2.3E-19 | 81 | 122 | IPR014977 | WRC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0048366 | Biological Process | leaf development | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0005524 | Molecular Function | ATP binding |
Plant Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PO Term | PO Category | PO Description | ||||
PO:0000037 | anatomy | shoot apex | ||||
PO:0009005 | anatomy | root | ||||
PO:0009009 | anatomy | plant embryo | ||||
PO:0009010 | anatomy | seed | ||||
PO:0009031 | anatomy | sepal | ||||
PO:0009032 | anatomy | petal | ||||
PO:0009046 | anatomy | flower | ||||
PO:0009052 | anatomy | flower pedicel | ||||
PO:0020144 | anatomy | apical meristem | ||||
PO:0025022 | anatomy | collective leaf structure | ||||
PO:0001078 | developmental stage | plant embryo cotyledonary stage | ||||
PO:0001081 | developmental stage | mature plant embryo stage | ||||
PO:0001185 | developmental stage | plant embryo globular stage | ||||
PO:0004507 | developmental stage | plant embryo bilateral stage | ||||
PO:0007611 | developmental stage | petal differentiation and expansion stage | ||||
PO:0007616 | developmental stage | flowering stage |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 244 aa Download sequence Send to blast |
MATRIPFTES QWEELENQAL VFKYLAANMP VPPHLLFLIK RPFLFSSSSS SSSSSSFFSP 60 TLSPHFGWNV YEMGMGRKID AEPGRCRRTD GKKWRCSKEA YPDSKYCERH MHRGKNRSSS 120 RKPPPTQFTP NLFLDSSSRR RRSGYMDDFF SIEPSGSIKS CSGSAMEDND DGSCRGINNE 180 EKQPDRHCFI LGTDLRTRER PLMLEEKLKQ RDHDNEEEQG SKRFYRFLDE WPSSKSSVST 240 SLFI |
Expression -- Microarray ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | E-value | ||||
Genevisible | 265531_at | 0.0 | ||||
Expression Atlas | AT2G06200 | - | ||||
AtGenExpress | AT2G06200 | - | ||||
ATTED-II | AT2G06200 | - |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: Expressed during the early stages of leaf development and expression decreases with the maturation of the leaf. {ECO:0000269|PubMed:20023165}. | |||||
Uniprot | TISSUE SPECIFICITY: Strongly expressed in actively growing and developing tissues, such as roots, upper stems, and shoot tips containing the shoot apical meristem (SAM) and flower buds. Also expressed in mature flowers, but weakly expressed in mature stems and leaves. {ECO:0000269|PubMed:12974814}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
TAIR | Growth regulating factor encoding transcription activator. One of the nine members of a GRF gene family, containing nuclear targeting domain. Involved in leaf development and expressed in root, shoot and flower | |||||
UniProt | Transcription activator that plays a role in the regulation of cell expansion in leaf and cotyledons tissues. {ECO:0000250}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00263 | DAP | 27203113 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | AT2G06200.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Phenotype -- Mutation ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | |||||
T-DNA Express | AT2G06200 |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AY060586 | 0.0 | AY060586.1 Arabidopsis thaliana At2g06200/F5K7.4 mRNA, complete cds. | |||
GenBank | AY125572 | 0.0 | AY125572.1 Arabidopsis thaliana At2g06200/F5K7.4 mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_001325112.1 | 0.0 | growth-regulating factor 6 | ||||
Refseq | NP_027759.1 | 0.0 | growth-regulating factor 6 | ||||
Swissprot | Q9ZQ12 | 0.0 | GRF6_ARATH; Growth-regulating factor 6 | ||||
TrEMBL | A0A178VWJ6 | 1e-180 | A0A178VWJ6_ARATH; GRF6 | ||||
TrEMBL | A0A1P8B259 | 1e-180 | A0A1P8B259_ARATH; Growth-regulating factor 6 | ||||
STRING | AT2G06200.1 | 0.0 | (Arabidopsis thaliana) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM14101 | 18 | 21 | Representative plant | OGRP460 | 16 | 84 |
Link Out ? help Back to Top | |
---|---|
Phytozome | AT2G06200.1 |
Entrez Gene | 815176 |
iHOP | AT2G06200 |
wikigenes | AT2G06200 |