Signature Domain? help Back to Top |
|
No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
1 | G2-like | 86.1 | 3.5e-27 | 200 | 253 | 1 | 55 |
G2-like 1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
k r++W+ eLH++Fv+av++L G++kA+Pk+ilelm+v+gL++e+v+SHLQk+Rl
AT2G01760.1 200 KSRVVWSIELHQQFVNAVNKL-GIDKAVPKRILELMNVPGLSRENVASHLQKFRL 253
68*******************.********************************8 PP
|
2 | Response_reg | 76.3 | 1.1e-25 | 13 | 122 | 1 | 109 |
EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHHHHTTES CS
Response_reg 1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedalealkaGak 95
+l+vdD+ + + +l+++l + y +v+ +++++ al++l+e++ +Dl+l D+ mpgm+G++ll++ e++lp+i+++ g +++ ++ Ga
AT2G01760.1 13 ILVVDDDTSCLFILEKMLLRLMY-QVTICSQADVALTILRERKdsFDLVLSDVHMPGMNGYNLLQQVGLLEMDLPVIMMSVDGRTTTVMTGINHGAC 108
89*********************.***************888889**************************************************** PP
EEEESS--HHHHHH CS
Response_reg 96 dflsKpfdpeelvk 109
d+l Kp+ peel +
AT2G01760.1 109 DYLIKPIRPEELKN 122
***********987 PP
|
Publications
? help Back to Top |
- Riechmann JL, et al.
Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes. Science, 2000. 290(5499): p. 2105-10 [PMID:11118137] - Hwang I,Sheen J
Two-component circuitry in Arabidopsis cytokinin signal transduction. Nature, 2001. 413(6854): p. 383-9 [PMID:11574878] - Hwang I,Chen HC,Sheen J
Two-component signal transduction pathways in Arabidopsis. Plant Physiol., 2002. 129(2): p. 500-15 [PMID:12068096] - Imamura A,Kiba T,Tajima Y,Yamashino T,Mizuno T
In vivo and in vitro characterization of the ARR11 response regulator implicated in the His-to-Asp phosphorelay signal transduction in Arabidopsis thaliana. Plant Cell Physiol., 2003. 44(2): p. 122-31 [PMID:12610214] - Heyl A,Schm
Cytokinin signal perception and transduction. Curr. Opin. Plant Biol., 2003. 6(5): p. 480-8 [PMID:12972049] - Dal Bosco C, et al.
Inactivation of the chloroplast ATP synthase gamma subunit results in high non-photochemical fluorescence quenching and altered nuclear gene expression in Arabidopsis thaliana. J. Biol. Chem., 2004. 279(2): p. 1060-9 [PMID:14576160] - Yamada K, et al.
Empirical analysis of transcriptional activity in the Arabidopsis genome. Science, 2003. 302(5646): p. 842-6 [PMID:14593172] - Hoth S, et al.
Monitoring genome-wide changes in gene expression in response to endogenous cytokinin reveals targets in Arabidopsis thaliana. FEBS Lett., 2003. 554(3): p. 373-80 [PMID:14623097] - Cluis CP,Mouchel CF,Hardtke CS
The Arabidopsis transcription factor HY5 integrates light and hormone signaling pathways. Plant J., 2004. 38(2): p. 332-47 [PMID:15078335] - Mason MG,Li J,Mathews DE,Kieber JJ,Schaller GE
Type-B response regulators display overlapping expression patterns in Arabidopsis. Plant Physiol., 2004. 135(2): p. 927-37 [PMID:15173562] - Brenner WG,Romanov GA,K
Immediate-early and delayed cytokinin response genes of Arabidopsis thaliana identified by genome-wide expression profiling reveal novel cytokinin-sensitive processes and suggest cytokinin action through transcriptional cascades. Plant J., 2005. 44(2): p. 314-33 [PMID:16212609] - Mason MG, et al.
Multiple type-B response regulators mediate cytokinin signal transduction in Arabidopsis. Plant Cell, 2005. 17(11): p. 3007-18 [PMID:16227453] - Pischke MS,Huttlin EL,Hegeman AD,Sussman MR
A transcriptome-based characterization of habituation in plant tissue culture. Plant Physiol., 2006. 140(4): p. 1255-78 [PMID:16489130] - Thilmony R,Underwood W,He SY
Genome-wide transcriptional analysis of the Arabidopsis thaliana interaction with the plant pathogen Pseudomonas syringae pv. tomato DC3000 and the human pathogen Escherichia coli O157:H7. Plant J., 2006. 46(1): p. 34-53 [PMID:16553894] - Dortay H,Mehnert N,B
Analysis of protein interactions within the cytokinin-signaling pathway of Arabidopsis thaliana. FEBS J., 2006. 273(20): p. 4631-44 [PMID:16965536] - Ishida K,Yamashino T,Yokoyama A,Mizuno T
Three type-B response regulators, ARR1, ARR10 and ARR12, play essential but redundant roles in cytokinin signal transduction throughout the life cycle of Arabidopsis thaliana. Plant Cell Physiol., 2008. 49(1): p. 47-57 [PMID:18037673] - Dortay H, et al.
Toward an interaction map of the two-component signaling pathway of Arabidopsis thaliana. J. Proteome Res., 2008. 7(9): p. 3649-60 [PMID:18642946] - Nemoto K, et al.
Autophosphorylation profiling of Arabidopsis protein kinases using the cell-free system. Phytochemistry, 2011. 72(10): p. 1136-44 [PMID:21477822] - Arabidopsis Interactome Mapping Consortium
Evidence for network evolution in an Arabidopsis interactome map. Science, 2011. 333(6042): p. 601-7 [PMID:21798944] - Mar
Large-scale identification of gibberellin-related transcription factors defines group VII ETHYLENE RESPONSE FACTORS as functional DELLA partners. Plant Physiol., 2014. 166(2): p. 1022-32 [PMID:25118255]
|