![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
Previous version:
v3.0
v4.0
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | AT2G01500.1 | ||||||||
Common Name | F2I9.12, HOS9, PFS2, WOX6 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
|
||||||||
Family | WOX | ||||||||
Protein Properties | Length: 271aa MW: 31452.8 Da PI: 7.0632 | ||||||||
Description | WOX family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Homeobox | 67.9 | 1.3e-21 | 61 | 118 | 4 | 56 |
-SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHH CS Homeobox 4 RttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakek 56 R+++t+eq+++Leel+++ +r+p++e+++++A+kl +++ ++V++WFqN++a+e+ AT2G01500.1 61 RWNPTPEQITTLEELYRSgTRTPTTEQIQQIASKLrkygRIEGKNVFYWFQNHKARER 118 *****************99*************************************98 PP | |||||||
2 | Wus_type_Homeobox | 113.7 | 9.4e-37 | 59 | 120 | 3 | 64 |
Wus_type_Homeobox 3 rtRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqk 64 + RW+PtpeQi+ Leely+sG+rtP++e+iq+i+++L++yG+ie+kNVfyWFQN+kaRer k AT2G01500.1 59 TLRWNPTPEQITTLEELYRSGTRTPTTEQIQQIASKLRKYGRIEGKNVFYWFQNHKARERLK 120 67**********************************************************88 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00389 | 1.9E-5 | 57 | 124 | IPR001356 | Homeobox domain |
SuperFamily | SSF46689 | 3.81E-12 | 59 | 119 | IPR009057 | Homeodomain-like |
CDD | cd00086 | 8.32E-5 | 61 | 115 | No hit | No description |
Pfam | PF00046 | 3.0E-19 | 61 | 118 | IPR001356 | Homeobox domain |
Gene3D | G3DSA:1.10.10.60 | 1.6E-8 | 61 | 118 | IPR009057 | Homeodomain-like |
PROSITE profile | PS50071 | 11.208 | 65 | 120 | IPR001356 | Homeobox domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0009409 | Biological Process | response to cold | ||||
GO:0009965 | Biological Process | leaf morphogenesis | ||||
GO:0016049 | Biological Process | cell growth | ||||
GO:0030154 | Biological Process | cell differentiation | ||||
GO:0048314 | Biological Process | embryo sac morphogenesis | ||||
GO:0048446 | Biological Process | petal morphogenesis | ||||
GO:0048482 | Biological Process | plant ovule morphogenesis | ||||
GO:0051301 | Biological Process | cell division | ||||
GO:0048353 | Cellular Component | primary endosperm nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding |
Plant Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PO Term | PO Category | PO Description | ||||
PO:0000005 | anatomy | cultured plant cell | ||||
PO:0000229 | anatomy | flower meristem | ||||
PO:0009009 | anatomy | plant embryo | ||||
PO:0009029 | anatomy | stamen | ||||
PO:0009030 | anatomy | carpel | ||||
PO:0009031 | anatomy | sepal | ||||
PO:0009032 | anatomy | petal | ||||
PO:0009049 | anatomy | inflorescence | ||||
PO:0009062 | anatomy | gynoecium | ||||
PO:0009071 | anatomy | anther wall tapetum | ||||
PO:0020003 | anatomy | plant ovule | ||||
PO:0020108 | anatomy | suspensor |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 271 aa Download sequence Send to blast |
MGYISNNNLI NYLPLSTTQP PLLLTHCDIN GNDHHQLITA SSGEHDIDER KNNIPAAATL 60 RWNPTPEQIT TLEELYRSGT RTPTTEQIQQ IASKLRKYGR IEGKNVFYWF QNHKARERLK 120 RRRREGGAII KPHKDVKDSS SGGHRVDQTK LCPSFPHTNR PQPQHELDPA SYNKDNNANN 180 EDHGTTEESD QRASEVGKYA TWRNLVTWSI TQQPEEINID ENVNGEEEET RDNRTLNLFP 240 VREYQEKTGR LIEKTKACNY CYYYEFMPLK N |
Expression -- Microarray ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | E-value | ||||
Genevisible | 266354_at | 0.0 | ||||
Expression Atlas | AT2G01500 | - | ||||
AtGenExpress | AT2G01500 | - | ||||
ATTED-II | AT2G01500 | - |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: In developing seeds, it is expressed in the embryo, suspensor and endosperm nuclei, but absent in the integuments. In seedlings, it is expressed in the shoot apical meristem and leaf primordia, but not in expanded cotyledons or mature leaves. In reproductive structures, transcripts could be detected in floral apical meristems, floral primordia, stamens and pistils. Also expressed in the tapetum in anthers and in the gynoecium. Weakly expressed in petals, sepals and the walls of carpels. {ECO:0000269|PubMed:15659481}. | |||||
Uniprot | TISSUE SPECIFICITY: Highly expressed in developing ovules. Present in developing primordia and differentiating organs but absent in mature organs. {ECO:0000269|PubMed:15659481}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
TAIR | PFS2 encodes a homeodomain gene that is a member of the WUS clade of transcription factors. It delays differentiation and maturation of primordia and regulates ovule patterning. The pfs2 mutant exhibits developmental defects in the maternal integuments and gametophyte, specifically, the boundary between the chalaza and the nucellus shifted towards the distal end of pfs2 ovule primordia. In addition, leaves displayed curling and petals were wavy and crenulated. Overexpression of PFS2 affects floral organ and leaf development. Single- and double-mutant analyses reveal that PFS2 activity represses AGAMOUS expression in young floral primordia. Also involved in regulation of response to low temperature. | |||||
UniProt | Transcription factor that plays a central role in ovule patterning by regulating cell proliferation of the maternal integuments and differentiation of the maegaspore mother cell (MCC). Involved in AGAMOUS (AG) repression in leaves. {ECO:0000269|PubMed:15659481}. |
Function -- GeneRIF ? help Back to Top | ||||||
---|---|---|---|---|---|---|
|
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | AT2G01500.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Regulation -- ATRM (Manually Curated Target Genes) ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Target Gene (A: Activate/R: Repress) | |||||
ATRM | AT4G18960(R) |
Phenotype -- Mutation ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | |||||
T-DNA Express | AT2G01500 |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AY085832 | 0.0 | AY085832.1 Arabidopsis thaliana clone 18820 mRNA, complete sequence. | |||
GenBank | AY251399 | 0.0 | AY251399.2 Arabidopsis thaliana WOX6 protein mRNA, complete cds. | |||
GenBank | AY885222 | 0.0 | AY885222.1 Arabidopsis thaliana pretty few seeds 2 (PFS2) mRNA, complete cds. | |||
GenBank | DQ446451 | 0.0 | DQ446451.1 Arabidopsis thaliana clone pENTR221-At2g01500 homeobox-leucine zipper transcription factor family protein (At2g01500) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_565263.1 | 0.0 | Homeodomain-like superfamily protein | ||||
Swissprot | Q9ZVF5 | 0.0 | WOX6_ARATH; WUSCHEL-related homeobox 6 | ||||
TrEMBL | A0A384KZD3 | 0.0 | A0A384KZD3_ARATH; WOX6 | ||||
TrEMBL | A0MEH4 | 0.0 | A0MEH4_ARATH; Uncharacterized protein (Fragment) | ||||
TrEMBL | Q1PFB2 | 0.0 | Q1PFB2_ARATH; Homeobox-leucine zipper transcription factor family protein | ||||
STRING | AT2G01500.1 | 0.0 | (Arabidopsis thaliana) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM13369 | 18 | 28 |
Link Out ? help Back to Top | |
---|---|
Phytozome | AT2G01500.1 |
Entrez Gene | 814678 |
iHOP | AT2G01500 |
wikigenes | AT2G01500 |