Signature Domain? help Back to Top |
|
No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
1 | bZIP_1 | 35.6 | 2e-11 | 92 | 134 | 4 | 46 |
XCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
bZIP_1 4 lkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLk 46
+k rr+++NReAAr+sR+RKka++++Lee +L++ ++L
AT1G77920.1 92 DKMKRRLAQNREAARKSRLRKKAYVQQLEESRLKLSQLEQELE 134
6899**************************8888887776554 PP
|
Publications
? help Back to Top |
- Després C,DeLong C,Glaze S,Liu E,Fobert PR
The Arabidopsis NPR1/NIM1 protein enhances the DNA binding activity of a subgroup of the TGA family of bZIP transcription factors. Plant Cell, 2000. 12(2): p. 279-90 [PMID:10662863] - Riechmann JL, et al.
Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes. Science, 2000. 290(5499): p. 2105-10 [PMID:11118137] - Reddy VS,Ali GS,Reddy AS
Genes encoding calmodulin-binding proteins in the Arabidopsis genome. J. Biol. Chem., 2002. 277(12): p. 9840-52 [PMID:11782485] - Jakoby M, et al.
bZIP transcription factors in Arabidopsis. Trends Plant Sci., 2002. 7(3): p. 106-11 [PMID:11906833] - Ma L, et al.
Genomic evidence for COP1 as a repressor of light-regulated gene expression and development in Arabidopsis. Plant Cell, 2002. 14(10): p. 2383-98 [PMID:12368493] - Després C, et al.
The Arabidopsis NPR1 disease resistance protein is a novel cofactor that confers redox regulation of DNA binding activity to the basic domain/leucine zipper transcription factor TGA1. Plant Cell, 2003. 15(9): p. 2181-91 [PMID:12953119] - Yamada K, et al.
Empirical analysis of transcriptional activity in the Arabidopsis genome. Science, 2003. 302(5646): p. 842-6 [PMID:14593172] - Deppmann CD, et al.
Dimerization specificity of all 67 B-ZIP motifs in Arabidopsis thaliana: a comparison to Homo sapiens B-ZIP motifs. Nucleic Acids Res., 2004. 32(11): p. 3435-45 [PMID:15226410] - Scheible WR, et al.
Genome-wide reprogramming of primary and secondary metabolism, protein synthesis, cellular growth processes, and the regulatory infrastructure of Arabidopsis in response to nitrogen. Plant Physiol., 2004. 136(1): p. 2483-99 [PMID:15375205] - Hampton CR, et al.
Cesium toxicity in Arabidopsis. Plant Physiol., 2004. 136(3): p. 3824-37 [PMID:15489280] - Liu G,Holub EB,Alonso JM,Ecker JR,Fobert PR
An Arabidopsis NPR1-like gene, NPR4, is required for disease resistance. Plant J., 2005. 41(2): p. 304-18 [PMID:15634206] - Hepworth SR,Zhang Y,McKim S,Li X,Haughn GW
BLADE-ON-PETIOLE-dependent signaling controls leaf and floral patterning in Arabidopsis. Plant Cell, 2005. 17(5): p. 1434-48 [PMID:15805484] - Duarte JM, et al.
Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] - Pischke MS,Huttlin EL,Hegeman AD,Sussman MR
A transcriptome-based characterization of habituation in plant tissue culture. Plant Physiol., 2006. 140(4): p. 1255-78 [PMID:16489130] - Deppmann CD,Alvania RS,Taparowsky EJ
Cross-species annotation of basic leucine zipper factor interactions: Insight into the evolution of closed interaction networks. Mol. Biol. Evol., 2006. 23(8): p. 1480-92 [PMID:16731568] - Kesarwani M,Yoo J,Dong X
Genetic interactions of TGA transcription factors in the regulation of pathogenesis-related genes and disease resistance in Arabidopsis. Plant Physiol., 2007. 144(1): p. 336-46 [PMID:17369431] - Ascencio-Ib
Global analysis of Arabidopsis gene expression uncovers a complex array of changes impacting pathogen response and cell cycle during geminivirus infection. Plant Physiol., 2008. 148(1): p. 436-54 [PMID:18650403] - Li S, et al.
Nuclear activity of ROXY1, a glutaredoxin interacting with TGA factors, is required for petal development in Arabidopsis thaliana. Plant Cell, 2009. 21(2): p. 429-41 [PMID:19218396] - Efroni I, et al.
Regulation of leaf maturation by chromatin-mediated modulation of cytokinin responses. Dev. Cell, 2013. 24(4): p. 438-45 [PMID:23449474] - Ding Y, et al.
Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444]
|