PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

AT1G77080.5

Common Name

AGL27, FLM, MAF1

Organism

Arabidopsis thaliana

Taxonomic ID

3702

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis

Family

MIKC_MADS

Protein Properties

Length: 173aa MW: 19786.6 Da PI: 6.3012

Description

MIKC_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
AT1G77080.5	genome	TAIR	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	68.4	7e-22	9	56	1	48
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEE CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklye 48 krienks rqvtfskRrng++ KA LS+LC+ vav+++s +gkly+ AT1G77080.5 9 KRIENKSSRQVTFSKRRNGLIDKARQLSILCESSVAVVVVSASGKLYD 56 79********************************************97 PP
2	K-box	38	7.1e-14	95	165	29	99
K-box 29 enLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkle 99 e L++ q +l ++++ s+ L +Le+qLe++l+ R++K el++e ie l++kek l+een+ L ++l AT1G77080.5 95 ELLETVQSKLEEPNVDNVSVDSLISLEEQLETALSVSRARKAELMMEYIESLKEKEKLLREENQVLASQLS 165 556666677777788999************************************************99986 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SuperFamily	SSF55455	1.05E-25	1	73	IPR002100	Transcription factor, MADS-box
PROSITE profile	PS50066	28.202	1	61	IPR002100	Transcription factor, MADS-box
SMART	SM00432	4.7E-33	1	60	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	1.5E-23	3	23	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	1.7E-21	10	55	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	1.5E-23	23	38	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	1.5E-23	38	59	IPR002100	Transcription factor, MADS-box
PROSITE profile	PS51297	12.322	80	170	IPR002487	Transcription factor, K-box
Pfam	PF01486	2.3E-11	95	164	IPR002487	Transcription factor, K-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0009910	Biological Process	negative regulation of flower development
GO:0048573	Biological Process	photoperiodism, flowering
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0005515	Molecular Function	protein binding
GO:0046983	Molecular Function	protein dimerization activity

Plant Ontology ? help Back to Top
PO Term	PO Category	PO Description
PO:0000013	anatomy	cauline leaf
PO:0000037	anatomy	shoot apex
PO:0000084	anatomy	plant sperm cell
PO:0000230	anatomy	inflorescence meristem
PO:0000293	anatomy	guard cell
PO:0006340	anatomy	adult vascular leaf
PO:0008019	anatomy	leaf lamina base
PO:0009005	anatomy	root
PO:0009006	anatomy	shoot system
PO:0009009	anatomy	plant embryo
PO:0009010	anatomy	seed
PO:0009025	anatomy	vascular leaf
PO:0009029	anatomy	stamen
PO:0009030	anatomy	carpel
PO:0009031	anatomy	sepal
PO:0009032	anatomy	petal
PO:0009046	anatomy	flower
PO:0009047	anatomy	stem
PO:0009052	anatomy	flower pedicel
PO:0020030	anatomy	cotyledon
PO:0020038	anatomy	petiole
PO:0020100	anatomy	hypocotyl
PO:0020137	anatomy	leaf apex
PO:0025022	anatomy	collective leaf structure
PO:0025281	anatomy	pollen
PO:0001054	developmental stage	vascular leaf senescent stage
PO:0001078	developmental stage	plant embryo cotyledonary stage
PO:0001081	developmental stage	mature plant embryo stage
PO:0001185	developmental stage	plant embryo globular stage
PO:0004507	developmental stage	plant embryo bilateral stage
PO:0007064	developmental stage	LP.12 twelve leaves visible stage
PO:0007095	developmental stage	LP.08 eight leaves visible stage
PO:0007098	developmental stage	LP.02 two leaves visible stage
PO:0007103	developmental stage	LP.10 ten leaves visible stage
PO:0007115	developmental stage	LP.04 four leaves visible stage
PO:0007123	developmental stage	LP.06 six leaves visible stage
PO:0007611	developmental stage	petal differentiation and expansion stage
PO:0007616	developmental stage	flowering stage

Sequence ? help Back to Top
Protein Sequence Length: 173 aa Download sequence Send to blast
MGRRKIEIKR IENKSSRQVT FSKRRNGLID KARQLSILCE SSVAVVVVSA SGKLYDSSSG 60 DDISKIIDRY EIQHADELRA LDLEEKIQNY LPHKELLETV QSKLEEPNVD NVSVDSLISL 120 EEQLETALSV SRARKAELMM EYIESLKEKE KLLREENQVL ASQLSEKKGM SHR

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
6byy_A	2e-15	1	70	1	69	MEF2 CHIMERA
6byy_B	2e-15	1	70	1	69	MEF2 CHIMERA
6byy_C	2e-15	1	70	1	69	MEF2 CHIMERA
6byy_D	2e-15	1	70	1	69	MEF2 CHIMERA
6bz1_A	1e-15	1	70	1	69	MEF2 CHIMERA
6bz1_B	1e-15	1	70	1	69	MEF2 CHIMERA
6bz1_C	1e-15	1	70	1	69	MEF2 CHIMERA
6bz1_D	1e-15	1	70	1	69	MEF2 CHIMERA
Search in ModeBase

Expression -- UniGene ? help Back to Top
UniGene ID	E-value	Expressed in
At.49225	1e-156	bud\| flower\| inflorescence\| leaf\| root

Expression -- Microarray ? help Back to Top
Source	ID	E-value
Genevisible	264949_at	1e-77
Expression Atlas	AT1G77080	-
AtGenExpress	AT1G77080	-
ATTED-II	AT1G77080	-

Expression -- Description ? help Back to Top
Source	Description
Uniprot	TISSUE SPECIFICITY: Expressed in most plant tissues, embryo, seedlings, roots, leaves, stems, inflorescence, pollen, siliques and flowers. {ECO:0000269\|PubMed:11115127, ECO:0000269\|PubMed:11351076, ECO:0000269\|PubMed:12837945, ECO:0000269\|PubMed:12949148}.

Functional Description ? help Back to Top
Source	Description
TAIR	MADS domain protein - flowering regulator that is closely related to FLC. Deletion of this locus in Nd ecotype is correlated with earlier flowering in short days suggesting function as a negative regulator of flowering.
UniProt	Probable transcription factor involved in the negative regulation of flowering time in both long and short days, probably through the photoperiodic and vernalization pathways. Prevents premature flowering. {ECO:0000269\|PubMed:11351076, ECO:0000269\|PubMed:14558654, ECO:0000269\|PubMed:15695584, ECO:0000269\|PubMed:18799658}.

Function -- GeneRIF ? help Back to Top
Our studies provide insight into the role of MPF2-like genes in phase transition by interacting with SOC1 and MAF1 genes, thereby also pointing to their significance as potential candidates for modifying flowering in crop plants in the future. [PMID: 22539207] Control of SVP-FLM-beta repressor complex abundance via transcriptional and splicing regulation of FLM and posttranslational regulation of SVP protein stability provides an efficient, rapid mechanism for plants to respond to ambient temperature changes. [PMID: 24030492] SVP-FLM-beta complex is predominately formed at low temperatures and prevents precocious flowering; by contrast, the competing SVP-FLM-delta complex is impaired in DNA binding and acts as a dominant-negative activator of flowering at higher temperatures [PMID: 24067612] FLM and MAF2 repress flowering in parallel at low temperature. [PMID: 25955034] we identify insertion polymorphisms in the first intron of FLM as causative for accelerated flowering in many natural A. thaliana accessions, especially in cool (15 degrees C) temperatures [PMID: 26492483] This study's findings suggest a model in which the loss of the floral repressor FLM occurs through mRNA degradation in response to elevated temperatures, signifying a role for alternative splicing coupled with nonsense-mediated mRNA decay (AS-NMD) in conferring environmental responses in plants. [PMID: 27243649] The data support the role of FLM-beta as a flower repressor and provide evidence that a contribution of FLM-delta to the regulation of flowering time in wild-type Arabidopsis thaliana seems unlikely. [PMID: 29036339] repressor activity is regulated by the TOR signaling pathway and is critical for cell survival during environmental stresses [PMID: 30293201]

Binding Motif ? help Back to Top
Motif ID	Method	Source	Motif file
MP00105	ChIP-seq	26531826	Download

Cis-element ? help Back to Top
Source	Link
PlantRegMap	AT1G77080.5

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Slightly repressed by vernalization. Negatively regulated at the chromatin level by VIL1 through the photoperiod and vernalization pathways. Requires EARLY FLOWERING 7 (ELF7) and ELF8 to be expressed. Up-regulated by HUA2. {ECO:0000269\|PubMed:11351076, ECO:0000269\|PubMed:15520273, ECO:0000269\|PubMed:15659097, ECO:0000269\|PubMed:17114575}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	Retrieve

Phenotype -- Mutation ? help Back to Top
Source	ID
T-DNA Express	AT1G77080

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AF312665	0.0	AF312665.1 Arabidopsis thaliana MADS-box protein AGL27-I (AGL27) mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	NP_974160.2	1e-119	K-box region and MADS-box transcription factor family protein
Swissprot	Q9AT76	1e-112	AGL27_ARATH; Agamous-like MADS-box protein AGL27
TrEMBL	A0A1P8ARE3	1e-111	A0A1P8ARE3_ARATH; K-box region and MADS-box transcription factor family protein
STRING	AT1G77080.4	1e-111	(Arabidopsis thaliana)

Link Out ? help Back to Top
Phytozome	AT1G77080.5
Entrez Gene	844042
iHOP	AT1G77080
wikigenes	AT1G77080

Publications ? help Back to Top
Alvarez-Buylla ER, et al. MADS-box gene evolution beyond flowers: expression in pollen, endosperm, guard cells, roots and trichomes. Plant J., 2000. 24(4): p. 457-66 [PMID:11115127] Riechmann JL, et al. Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes. Science, 2000. 290(5499): p. 2105-10 [PMID:11118137] Ratcliffe OJ,Nadzan GC,Reuber TL,Riechmann JL Regulation of flowering in Arabidopsis by an FLC homologue. Plant Physiol., 2001. 126(1): p. 122-32 [PMID:11351076] Scortecci KC,Michaels SD,Amasino RM Identification of a MADS-box gene, FLOWERING LOCUS M, that represses flowering. Plant J., 2001. 26(2): p. 229-36 [PMID:11389763] Pelaz S,Gustafson-Brown C,Kohalmi SE,Crosby WL,Yanofsky MF APETALA1 and SEPALLATA3 interact to promote flower development. Plant J., 2001. 26(4): p. 385-94 [PMID:11439126] Michaels SD, et al. AGL24 acts as a promoter of flowering in Arabidopsis and is positively regulated by vernalization. Plant J., 2003. 33(5): p. 867-74 [PMID:12609028] Scortecci K,Michaels SD,Amasino RM Genetic interactions between FLM and other flowering-time genes in Arabidopsis thaliana. Plant Mol. Biol., 2003. 52(5): p. 915-22 [PMID:14558654] Oh S,Zhang H,Ludwig P,van Nocker S A mechanism related to the yeast transcriptional regulator Paf1c is required for expression of the Arabidopsis FLC/MAF MADS box gene family. Plant Cell, 2004. 16(11): p. 2940-53 [PMID:15472079] Doyle MR, et al. HUA2 is required for the expression of floral repressors in Arabidopsis thaliana. Plant J., 2005. 41(3): p. 376-85 [PMID:15659097] Werner JD, et al. Quantitative trait locus mapping and DNA array hybridization identify an FLM deletion as a cause for natural flowering-time variation. Proc. Natl. Acad. Sci. U.S.A., 2005. 102(7): p. 2460-5 [PMID:15695584] de Folter S, et al. Comprehensive interaction map of the Arabidopsis MADS Box transcription factors. Plant Cell, 2005. 17(5): p. 1424-33 [PMID:15805477] Lehti-Shiu MD,Adamczyk BJ,Fernandez DE Expression of MADS-box genes during the embryonic phase in Arabidopsis. Plant Mol. Biol., 2005. 58(1): p. 89-107 [PMID:16028119] Kim SY, et al. Establishment of the vernalization-responsive, winter-annual habit in Arabidopsis requires a putative histone H3 methyl transferase. Plant Cell, 2005. 17(12): p. 3301-10 [PMID:16258034] Balasubramanian S,Sureshkumar S,Lempe J,Weigel D Potent induction of Arabidopsis thaliana flowering by elevated growth temperature. PLoS Genet., 2006. 2(7): p. e106 [PMID:16839183] Sung S,Schmitz RJ,Amasino RM A PHD finger protein involved in both the vernalization and photoperiod pathways in Arabidopsis. Genes Dev., 2006. 20(23): p. 3244-8 [PMID:17114575] Li Y,Roycewicz P,Smith E,Borevitz JO Genetics of local adaptation in the laboratory: flowering time quantitative trait loci under geographic and seasonal conditions in Arabidopsis. PLoS ONE, 2006. 1: p. e105 [PMID:17205109] Kuhn JM,Breton G,Schroeder JI mRNA metabolism of flowering-time regulators in wild-type Arabidopsis revealed by a nuclear cap binding protein mutant, abh1. Plant J., 2007. 50(6): p. 1049-62 [PMID:17488241] Andersson CR, et al. The FLX gene of Arabidopsis is required for FRI-dependent activation of FLC expression. Plant Cell Physiol., 2008. 49(2): p. 191-200 [PMID:18156133] Ascencio-Ib Global analysis of Arabidopsis gene expression uncovers a complex array of changes impacting pathogen response and cell cycle during geminivirus infection. Plant Physiol., 2008. 148(1): p. 436-54 [PMID:18650403] Pouteau S, et al. Diversification of photoperiodic response patterns in a collection of early-flowering mutants of Arabidopsis. Plant Physiol., 2008. 148(3): p. 1465-73 [PMID:18799658] Mathieu J,Yant LJ,Mürdter F,Küttner F,Schmid M Repression of flowering by the miR172 target SMZ. PLoS Biol., 2009. 7(7): p. e1000148 [PMID:19582143] Balasubramanian S,Weigel D Temperature Induced Flowering in Arabidopsis thaliana. Plant Signal Behav, 2006. 1(5): p. 227-8 [PMID:19704664] Laluk K,Mengiste T The Arabidopsis extracellular UNUSUAL SERINE PROTEASE INHIBITOR functions in resistance to necrotrophic fungi and insect herbivory. Plant J., 2011. 68(3): p. 480-94 [PMID:21749505] Arabidopsis Interactome Mapping Consortium Evidence for network evolution in an Arabidopsis interactome map. Science, 2011. 333(6042): p. 601-7 [PMID:21798944] Yun JY,Tamada Y,Kang YE,Amasino RM Arabidopsis trithorax-related3/SET domain GROUP2 is required for the winter-annual habit of Arabidopsis thaliana. Plant Cell Physiol., 2012. 53(5): p. 834-46 [PMID:22378382] Khan MR,Khan IU,Ali GM MPF2-like MADS-box genes affecting expression of SOC1 and MAF1 are recruited to control flowering time. Mol. Biotechnol., 2013. 54(1): p. 25-36 [PMID:22539207] Meinke DW A survey of dominant mutations in Arabidopsis thaliana. Trends Plant Sci., 2013. 18(2): p. 84-91 [PMID:22995285] Lee JH, et al. Regulation of temperature-responsive flowering by MADS-box transcription factor repressors. Science, 2013. 342(6158): p. 628-32 [PMID:24030492] Pos Temperature-dependent regulation of flowering by antagonistic FLM variants. Nature, 2013. 503(7476): p. 414-7 [PMID:24067612] Hwan Lee J,Sook Chung K,Kim SK,Ahn JH Post-translational regulation of short vegetative phase as a major mechanism for thermoregulation of flowering. Plant Signal Behav, 2014. 9(3): p. e28193 [PMID:24614351] Hwan Lee J,Sook Chung K,Kim SK,Ahn JH Post-translational regulation of SHORT VEGETATIVE PHASE as a major mechanism for thermoregulation of flowering. Plant Signal Behav, 2014. 9(4): p. e28193 [PMID:25764420] Luo M, et al. Regulation of flowering time by the histone deacetylase HDA5 in Arabidopsis. Plant J., 2015. 82(6): p. 925-36 [PMID:25922987] Airoldi CA,McKay M,Davies B MAF2 Is Regulated by Temperature-Dependent Splicing and Represses Flowering at Low Temperatures in Parallel with FLM. PLoS ONE, 2015. 10(5): p. e0126516 [PMID:25955034] Lutz U, et al. Modulation of Ambient Temperature-Dependent Flowering in Arabidopsis thaliana by Natural Variation of FLOWERING LOCUS M. PLoS Genet., 2015. 11(10): p. e1005588 [PMID:26492483] Sureshkumar S,Dent C,Seleznev A,Tasset C,Balasubramanian S Nonsense-mediated mRNA decay modulates FLM-dependent thermosensory flowering response in Arabidopsis. Nat Plants, 2016. 2(5): p. 16055 [PMID:27243649] Lutz U, et al. Natural haplotypes of FLM non-coding sequences fine-tune flowering time in ambient spring temperatures in Arabidopsis. Elife, 2018. [PMID:28294941] Capovilla G,Symeonidi E,Wu R,Schmid M Contribution of major FLM isoforms to temperature-dependent flowering in Arabidopsis thaliana. J. Exp. Bot., 2017. 68(18): p. 5117-5127 [PMID:29036339] Ahn CS,Lee DH,Pai HS Characterization of Maf1 in Arabidopsis: function under stress conditions and regulation by the TOR signaling pathway. Planta, 2019. 249(2): p. 527-542 [PMID:30293201]