Signature Domain? help Back to Top |
|
No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
1 | Myb_DNA-binding | 57 | 4.5e-18 | 14 | 61 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
+g+WT+eEd +lv +++q+G+g+W+++++ g+ R+ k+c++rw +yl
AT1G74650.1 14 KGPWTPEEDIILVSYIQQHGPGNWRSVPANTGLLRCSKSCRLRWTNYL 61
79******************************99************97 PP
|
2 | Myb_DNA-binding | 46.3 | 1e-14 | 67 | 112 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
rg++T+ E++ ++++ ++lG++ W++Ia++++ Rt++++k++w+++l
AT1G74650.1 67 RGNFTQPEEKMIIHLQALLGNR-WAAIASYLP-QRTDNDIKNYWNTHL 112
89********************.*********.************996 PP
|
Publications
? help Back to Top |
- Geri C,Cecchini E,Giannakou ME,Covey SN,Milner JJ
Altered patterns of gene expression in Arabidopsis elicited by cauliflower mosaic virus (CaMV) infection and by a CaMV gene VI transgene. Mol. Plant Microbe Interact., 1999. 12(5): p. 377-84 [PMID:10226370] - Riechmann JL, et al.
Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes. Science, 2000. 290(5499): p. 2105-10 [PMID:11118137] - Stracke R,Werber M,Weisshaar B
The R2R3-MYB gene family in Arabidopsis thaliana. Curr. Opin. Plant Biol., 2001. 4(5): p. 447-56 [PMID:11597504] - Goda H, et al.
Comprehensive comparison of auxin-regulated and brassinosteroid-regulated genes in Arabidopsis. Plant Physiol., 2004. 134(4): p. 1555-73 [PMID:15047898] - Contento AL,Kim SJ,Bassham DC
Transcriptome profiling of the response of Arabidopsis suspension culture cells to Suc starvation. Plant Physiol., 2004. 135(4): p. 2330-47 [PMID:15310832] - Duarte JM, et al.
Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] - Yanhui C, et al.
The MYB transcription factor superfamily of Arabidopsis: expression analysis and phylogenetic comparison with the rice MYB family. Plant Mol. Biol., 2006. 60(1): p. 107-24 [PMID:16463103] - Libault M,Wan J,Czechowski T,Udvardi M,Stacey G
Identification of 118 Arabidopsis transcription factor and 30 ubiquitin-ligase genes responding to chitin, a plant-defense elicitor. Mol. Plant Microbe Interact., 2007. 20(8): p. 900-11 [PMID:17722694] - Ding Y, et al.
Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] - Lee HG,Seo PJ
The MYB96-HHP module integrates cold and abscisic acid signaling to activate the CBF-COR pathway in Arabidopsis. Plant J., 2015. 82(6): p. 962-77 [PMID:25912720] - Lee HG,Mas P,Seo PJ
MYB96 shapes the circadian gating of ABA signaling in Arabidopsis. Sci Rep, 2016. 6: p. 17754 [PMID:26725725] - Cui F, et al.
Dissecting Abscisic Acid Signaling Pathways Involved in Cuticle Formation. Mol Plant, 2016. 9(6): p. 926-38 [PMID:27060495] - Lee HG,Choi YR,Seo PJ
Increased STM expression is associated with drought tolerance in Arabidopsis. J. Plant Physiol., 2016. 201: p. 79-84 [PMID:27448723] - Lee SB,Kim HU,Suh MC
MYB94 and MYB96 Additively Activate Cuticular Wax Biosynthesis in Arabidopsis. Plant Cell Physiol., 2016. 57(11): p. 2300-2311 [PMID:27577115] - Lee HG,Seo PJ
The Arabidopsis MIEL1 E3 ligase negatively regulates ABA signalling by promoting protein turnover of MYB96. Nat Commun, 2016. 7: p. 12525 [PMID:27615387] - Li P, et al.
The Arabidopsis UGT87A2, a stress-inducible family 1 glycosyltransferase, is involved in the plant adaptation to abiotic stresses. Physiol Plant, 2017. 159(4): p. 416-432 [PMID:27747895] - Lee HG,Kim J,Suh MC,Seo PJ
The MIEL1 E3 Ubiquitin Ligase Negatively Regulates Cuticular Wax Biosynthesis in Arabidopsis Stems. Plant Cell Physiol., 2017. 58(7): p. 1249-1259 [PMID:28838126] - Lee HG,Kim H,Suh MC,Kim HU,Seo PJ
The MYB96 Transcription Factor Regulates Triacylglycerol Accumulation by Activating DGAT1 and PDAT1 Expression in Arabidopsis Seeds. Plant Cell Physiol., 2018. 59(7): p. 1432-1442 [PMID:29660088] - Lee HG,Seo PJ
MYB96 recruits the HDA15 protein to suppress negative regulators of ABA signaling in Arabidopsis. Nat Commun, 2019. 10(1): p. 1713 [PMID:30979883]
|