PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

AT1G71930.1

Common Name

ANAC030, F17M19.8, NAC030, VND7

Organism

Arabidopsis thaliana

Taxonomic ID

3702

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis

Family

NAC

Protein Properties

Length: 324aa MW: 37426.6 Da PI: 6.509

Description

vascular related NAC-domain protein 7

Gene Model

Gene Model ID	Type	Source	Coding Sequence
AT1G71930.1	genome	TAIR	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NAM	170.2	6.7e-53	9	137	1	128
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk...kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 +ppGfrFhPt+eelv +yL +k+++ k l +vi e+d+yk+ePwd+++ ++e++ewyfFs++d+ky+tg+r+nrat++g+Wkatg+dk+vls AT1G71930.1 9 MPPGFRFHPTEEELVGYYLDRKINSMKSAL-DVIVEIDLYKMEPWDIQArckLGYEEQNEWYFFSHKDRKYPTGTRTNRATAAGFWKATGRDKAVLS- 104 79***********************887.99**********953432233677**********************************. PP NAM 96 kgelvglkktLvfykgrapkgektdWvmheyrl 128 k++++g++ktLv+ykgrap+g+k+dW+mheyrl AT1G71930.1 105 KNSVIGMRKTLVYYKGRAPNGRKSDWIMHEYRL 137 8889*************************98 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SuperFamily	SSF101941	1.06E-59	4	158	IPR003441	NAC domain
PROSITE profile	PS51005	57.334	9	158	IPR003441	NAC domain
Pfam	PF02365	7.6E-28	10	137	IPR003441	NAC domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0007275	Biological Process	multicellular organism development
GO:0009735	Biological Process	response to cytokinin
GO:0009737	Biological Process	response to abscisic acid
GO:0009741	Biological Process	response to brassinosteroid
GO:0045491	Biological Process	xylan metabolic process
GO:0045893	Biological Process	positive regulation of transcription, DNA-templated
GO:0048759	Biological Process	xylem vessel member cell differentiation
GO:0050832	Biological Process	defense response to fungus
GO:0071365	Biological Process	cellular response to auxin stimulus
GO:0071555	Biological Process	cell wall organization
GO:0090059	Biological Process	protoxylem development
GO:0005634	Cellular Component	nucleus
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0042803	Molecular Function	protein homodimerization activity
GO:0043565	Molecular Function	sequence-specific DNA binding
GO:0044212	Molecular Function	transcription regulatory region DNA binding
GO:0046982	Molecular Function	protein heterodimerization activity

Plant Ontology ? help Back to Top
PO Term	PO Category	PO Description
PO:0000039	anatomy	shoot axis vascular system
PO:0000230	anatomy	inflorescence meristem
PO:0000272	anatomy	protoxylem
PO:0003011	anatomy	root vascular system
PO:0003015	anatomy	primary root differentiation zone
PO:0005352	anatomy	xylem
PO:0009005	anatomy	root
PO:0009006	anatomy	shoot system
PO:0009025	anatomy	vascular leaf
PO:0009030	anatomy	carpel
PO:0009046	anatomy	flower
PO:0020038	anatomy	petiole
PO:0020100	anatomy	hypocotyl
PO:0025257	anatomy	primary root elongation zone
PO:0007098	developmental stage	LP.02 two leaves visible stage
PO:0007611	developmental stage	petal differentiation and expansion stage

Sequence ? help Back to Top
Protein Sequence Length: 324 aa Download sequence Send to blast
MDNIMQSSMP PGFRFHPTEE ELVGYYLDRK INSMKSALDV IVEIDLYKME PWDIQARCKL 60 GYEEQNEWYF FSHKDRKYPT GTRTNRATAA GFWKATGRDK AVLSKNSVIG MRKTLVYYKG 120 RAPNGRKSDW IMHEYRLQNS ELAPVQEEGW VVCRAFRKPI PNQRPLGYEP WQNQLYHVES 180 SNNYSSSVTM NTSHHIGASS SSHNLNQMLM SNNHYNPNNT SSSMHQYGNI ELPQLDSPSL 240 SPSLGTNKDQ NESFEQEEEK SFNCVDWRTL DTLLETQVIH PHNPNILMFE TQSYNPAPSF 300 PSMHQSYNEV EANIHHSLGC FPDS

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1ut4_A	3e-49	2	158	10	165	NO APICAL MERISTEM PROTEIN
1ut4_B	3e-49	2	158	10	165	NO APICAL MERISTEM PROTEIN
1ut7_A	3e-49	2	158	10	165	NO APICAL MERISTEM PROTEIN
1ut7_B	3e-49	2	158	10	165	NO APICAL MERISTEM PROTEIN
3swm_A	4e-49	2	158	13	168	NAC domain-containing protein 19
3swm_B	4e-49	2	158	13	168	NAC domain-containing protein 19
3swm_C	4e-49	2	158	13	168	NAC domain-containing protein 19
3swm_D	4e-49	2	158	13	168	NAC domain-containing protein 19
3swp_A	4e-49	2	158	13	168	NAC domain-containing protein 19
3swp_B	4e-49	2	158	13	168	NAC domain-containing protein 19
3swp_C	4e-49	2	158	13	168	NAC domain-containing protein 19
3swp_D	4e-49	2	158	13	168	NAC domain-containing protein 19
3ulx_A	4e-49	2	158	8	168	Stress-induced transcription factor NAC1
4dul_A	3e-49	2	158	10	165	NAC domain-containing protein 19
4dul_B	3e-49	2	158	10	165	NAC domain-containing protein 19
Search in ModeBase

Expression -- Microarray ? help Back to Top
Source	ID	E-value
Genevisible	260173_at	0.0
Expression Atlas	AT1G71930	-
AtGenExpress	AT1G71930	-
ATTED-II	AT1G71930	-

Expression -- Description ? help Back to Top
Source	Description
Uniprot	DEVELOPMENTAL STAGE: Predominantly expressed in immature xylem vessels, only in some cells just beside xylem vessels. Also present in various vascular cells of older part of the roots, near the location of emergence of the lateral roots. {ECO:0000269\|PubMed:16103214, ECO:0000269\|PubMed:18445131}.
Uniprot	TISSUE SPECIFICITY: Expressed in developing protoxylems in roots and shoots (PubMed:16103214, PubMed:16581911, PubMed:17565617, PubMed:18952777). Detected in root protoxylem poles and in vessels of protoxylems, outermost metaxylems, inner metaxylems, shoots and hypocotyls. Expressed in roots, hypocotyls, cotyledons and leaves (PubMed:18445131). Accumulates in the xylem but not in interfascicular fibers or pith cells in inflorescence stems. Present in developing vessels of the secondary xylem in roots undergoing secondary growth (PubMed:18952777). {ECO:0000269\|PubMed:16103214, ECO:0000269\|PubMed:16581911, ECO:0000269\|PubMed:17565617, ECO:0000269\|PubMed:18445131, ECO:0000269\|PubMed:18952777}.

Functional Description ? help Back to Top
Source	Description
TAIR	Encodes a NAC-domain transcription factor with transcriptional activation activity that is involved in xylem formation. Induces transdifferentiation of various cells into protoxylem vessel elements. Located in the nucleus. Expression induced in the presence of auxin, cytokinin and brassinosteroids.
UniProt	Transcription activator that binds to the secondary wall NAC binding element (SNBE), 5'-(T/A)NN(C/T)(T/C/G)TNNNNNNNA(A/C)GN(A/C/T)(A/T)-3', in the promoter of target genes (e.g. genes involved in secondary wall biosynthesis, cell wall modification such as xylan accumulation, and programmed cell death) (PubMed:20935069, PubMed:20488898, PubMed:22037706, PubMed:21284754). Involved in xylem formation in roots and shoots, especially regulating protoxylem vessel differentiation by promoting immature xylem vessel-specific genes expression (PubMed:16103214, PubMed:18445131, PubMed:20488898, PubMed:21498679, PubMed:21284754). Can activate the expression of several genes including XCP1, MYB46, NAC010/SND3, MYB103, MYB58, MYB63, MYB83, KNAT7, ASL19 and ASL20 (PubMed:17890373, PubMed:19088331, PubMed:18952777, PubMed:19122102, PubMed:19808805, PubMed:20935069, PubMed:21284754). {ECO:0000269\|PubMed:16103214, ECO:0000269\|PubMed:17890373, ECO:0000269\|PubMed:18445131, ECO:0000269\|PubMed:18952777, ECO:0000269\|PubMed:19088331, ECO:0000269\|PubMed:19122102, ECO:0000269\|PubMed:19808805, ECO:0000269\|PubMed:20488898, ECO:0000269\|PubMed:20935069, ECO:0000269\|PubMed:21284754, ECO:0000269\|PubMed:21498679, ECO:0000269\|PubMed:22037706}.; FUNCTION: Required for the soilborne fungal pathogen Verticillium longisporum-induced transdifferentiation of chloroplast-containing bundle sheath cells to functional xylem elements leading to stunted growth, vein clearing, and leaf chloroses, as well as xylem hyperplasia within the vasculature of leaves, hypocotyls, and roots due to reinitiation of cambial activity and transdifferentiation of xylem parenchyma cells. This developmental reprogramming mediates also an increased drought stress tolerance. {ECO:0000269\|PubMed:23023171}.

Function -- GeneRIF ? help Back to Top
transcription switch for plant metaxylem and protoxylem vessel formation. [VASCULAR-RELATED NAC-DOMAIN7 ] [Vnd7] [PMID: 16103214] VASCULAR-RELATED NAC-DOMAIN PROTEIN6 (VND6) and VND7, which are transcription factors required for TE differentiation, determine ASL19 and ASL20 expression in immature tracheary elements (TEs). [PMID: 19088331] A glucocorticoid-mediated posttranslational induction system of VND6 and VND7, is reported. [PMID: 20488898] VND7 regulates patterns of secondary cell wall deposition in vascular vessels. [PMID: 21284754] Verticillium-infected Arabidopsis wild-type plants show higher drought stress tolerance compared with noninfected plants, whereas this effect is attenuated by suppression of VND7 activity. [PMID: 23023171] VND7 transcription is a regulatory target of multiple classes of transcription factors. [PMID: 25265867] Data show that photosynthesis-related genes were down-regulated after vascular related NAC-domain protein 7 (VND7) induction. [PMID: 27566165] AtGLR3.4-mediated Ca2+ influx may be involved in the regulation of seed germination under salt stress [PMID: 29444288]

Binding Motif ? help Back to Top
Motif ID	Method	Source	Motif file
MP00017	PBM	25378322	Download

Cis-element ? help Back to Top
Source	Link
PlantRegMap	AT1G71930.1

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By brassinosteroids (e.g. brassinolide BL), auxin (e.g. 2,4-dichlorphenoxyacetic acid 2,4-D) and cytokinin (e.g. kinetin), with a synergistic effect (PubMed:16103214, PubMed:22345435). Up-regulated in a feed-back loop by ASL20 (PubMed:19088331). Levels are monitored by proteasome-mediated degradation (PubMed:18445131). Repressed by WEE1 upon replication stress to prevent premature tracheary element differentiation (PubMed:21498679). Accumulates during infection by the soilborne fungal pathogen Verticillium longisporum, especially in tissues undergoing de novo xylem formation (PubMed:23023171). {ECO:0000269\|PubMed:16103214, ECO:0000269\|PubMed:18445131, ECO:0000269\|PubMed:19088331, ECO:0000269\|PubMed:21498679, ECO:0000269\|PubMed:22345435, ECO:0000269\|PubMed:23023171}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	Retrieve

Regulation -- ATRM (Manually Curated Target Genes) ? help Back to Top
Source	Target Gene (A: Activate/R: Repress)
ATRM	AT1G16490(A), AT1G28470(A), AT1G62990(A), AT1G79180(A), AT2G38080(A), AT5G12870(A), AT5G17420(A), AT5G56110(A)

Regulation -- Hormone ? help Back to Top
Source	Hormone
AHD	abscisic acid, brassinosteroid, cytokinin

Interaction ? help Back to Top
Source	Intact With
IntAct	Search Q9C8W9

Phenotype -- Disruption Phenotype ? help Back to Top
Source	Description
UniProt	DISRUPTION PHENOTYPE: Defects in protoxylem vessel formation in seedling roots. {ECO:0000269\|PubMed:16103214, ECO:0000269\|PubMed:18445131}.

Phenotype -- Mutation ? help Back to Top
Source	ID
T-DNA Express	AT1G71930

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	BT026447	0.0	BT026447.1 Arabidopsis thaliana At1g71930 mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	NP_001323397.1	0.0	vascular related NAC-domain protein 7
Refseq	NP_177338.1	0.0	vascular related NAC-domain protein 7
Swissprot	Q9C8W9	0.0	NAC30_ARATH; NAC domain-containing protein 30
TrEMBL	A0A178WQ46	0.0	A0A178WQ46_ARATH; VND7
STRING	AT1G71930.1	0.0	(Arabidopsis thaliana)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM6950	27	44
Representative plant	OGRP17	15	800

Link Out ? help Back to Top
Phytozome	AT1G71930.1
Entrez Gene	843524
iHOP	AT1G71930
wikigenes	AT1G71930

Publications ? help Back to Top
Riechmann JL, et al. Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes. Science, 2000. 290(5499): p. 2105-10 [PMID:11118137] Ooka H, et al. Comprehensive analysis of NAC family genes in Oryza sativa and Arabidopsis thaliana. DNA Res., 2003. 10(6): p. 239-47 [PMID:15029955] Kubo M, et al. Transcription switches for protoxylem and metaxylem vessel formation. Genes Dev., 2005. 19(16): p. 1855-60 [PMID:16103214] Mitsuda N,Seki M,Shinozaki K,Ohme-Takagi M The NAC transcription factors NST1 and NST2 of Arabidopsis regulate secondary wall thickenings and are required for anther dehiscence. Plant Cell, 2005. 17(11): p. 2993-3006 [PMID:16214898] Lee JY, et al. Transcriptional and posttranscriptional regulation of transcription factor expression in Arabidopsis roots. Proc. Natl. Acad. Sci. U.S.A., 2006. 103(15): p. 6055-60 [PMID:16581911] Mace DL, et al. Quantification of transcription factor expression from Arabidopsis images. Bioinformatics, 2006. 22(14): p. e323-31 [PMID:16873489] Zhong R,Demura T,Ye ZH SND1, a NAC domain transcription factor, is a key regulator of secondary wall synthesis in fibers of Arabidopsis. Plant Cell, 2006. 18(11): p. 3158-70 [PMID:17114348] Yang C, et al. Arabidopsis MYB26/MALE STERILE35 regulates secondary thickening in the endothecium and is essential for anther dehiscence. Plant Cell, 2007. 19(2): p. 534-48 [PMID:17329564] Ko JH,Yang SH,Park AH,Lerouxel O,Han KH ANAC012, a member of the plant-specific NAC transcription factor family, negatively regulates xylary fiber development in Arabidopsis thaliana. Plant J., 2007. 50(6): p. 1035-48 [PMID:17565617] Zhong R,Richardson EA,Ye ZH The MYB46 transcription factor is a direct target of SND1 and regulates secondary wall biosynthesis in Arabidopsis. Plant Cell, 2007. 19(9): p. 2776-92 [PMID:17890373] Yamaguchi M,Kubo M,Fukuda H,Demura T Vascular-related NAC-DOMAIN7 is involved in the differentiation of all types of xylem vessels in Arabidopsis roots and shoots. Plant J., 2008. 55(4): p. 652-64 [PMID:18445131] Zhong R,Lee C,Zhou J,McCarthy RL,Ye ZH A battery of transcription factors involved in the regulation of secondary cell wall biosynthesis in Arabidopsis. Plant Cell, 2008. 20(10): p. 2763-82 [PMID:18952777] Soyano T,Thitamadee S,Machida Y,Chua NH ASYMMETRIC LEAVES2-LIKE19/LATERAL ORGAN BOUNDARIES DOMAIN30 and ASL20/LBD18 regulate tracheary element differentiation in Arabidopsis. Plant Cell, 2008. 20(12): p. 3359-73 [PMID:19088331] Zhou J,Lee C,Zhong R,Ye ZH MYB58 and MYB63 are transcriptional activators of the lignin biosynthetic pathway during secondary cell wall formation in Arabidopsis. Plant Cell, 2009. 21(1): p. 248-66 [PMID:19122102] McCarthy RL,Zhong R,Ye ZH MYB83 is a direct target of SND1 and acts redundantly with MYB46 in the regulation of secondary cell wall biosynthesis in Arabidopsis. Plant Cell Physiol., 2009. 50(11): p. 1950-64 [PMID:19808805] Yamaguchi M, et al. VND-INTERACTING2, a NAC domain transcription factor, negatively regulates xylem vessel formation in Arabidopsis. Plant Cell, 2010. 22(4): p. 1249-63 [PMID:20388856] Yamaguchi M, et al. VASCULAR-RELATED NAC-DOMAIN6 and VASCULAR-RELATED NAC-DOMAIN7 effectively induce transdifferentiation into xylem vessel elements under control of an induction system. Plant Physiol., 2010. 153(3): p. 906-14 [PMID:20488898] Zhong R,Lee C,Ye ZH Global analysis of direct targets of secondary wall NAC master switches in Arabidopsis. Mol Plant, 2010. 3(6): p. 1087-103 [PMID:20935069] Brady SM, et al. A stele-enriched gene regulatory network in the Arabidopsis root. Mol. Syst. Biol., 2011. 7: p. 459 [PMID:21245844] Yamaguchi M, et al. VASCULAR-RELATED NAC-DOMAIN7 directly regulates the expression of a broad range of genes for xylem vessel formation. Plant J., 2011. 66(4): p. 579-90 [PMID:21284754] Cools T, et al. The Arabidopsis thaliana checkpoint kinase WEE1 protects against premature vascular differentiation during replication stress. Plant Cell, 2011. 23(4): p. 1435-48 [PMID:21498679] Ohtani M, et al. A NAC domain protein family contributing to the regulation of wood formation in poplar. Plant J., 2011. 67(3): p. 499-512 [PMID:21649762] McCarthy RL,Zhong R,Ye ZH Secondary wall NAC binding element (SNBE), a key cis-acting element required for target gene activation by secondary wall NAC master switches. Plant Signal Behav, 2011. 6(9): p. 1282-5 [PMID:21847026] Gaudinier A, et al. Enhanced Y1H assays for Arabidopsis. Nat. Methods, 2011. 8(12): p. 1053-5 [PMID:22037706] Yoshimoto K, et al. A chemical biology approach reveals an opposite action between thermospermine and auxin in xylem development in Arabidopsis thaliana. Plant Cell Physiol., 2012. 53(4): p. 635-45 [PMID:22345435] Heyndrickx KS,Vandepoele K Systematic identification of functional plant modules through the integration of complementary data sources. Plant Physiol., 2012. 159(3): p. 884-901 [PMID:22589469] Reusche M, et al. Verticillium infection triggers VASCULAR-RELATED NAC DOMAIN7-dependent de novo xylem formation and enhances drought tolerance in Arabidopsis. Plant Cell, 2012. 24(9): p. 3823-37 [PMID:23023171] Petersen PD, et al. Engineering of plants with improved properties as biofuels feedstocks by vessel-specific complementation of xylan biosynthesis mutants. Biotechnol Biofuels, 2012. 5(1): p. 84 [PMID:23181474] Endo H, et al. Multiple classes of transcription factors regulate the expression of VASCULAR-RELATED NAC-DOMAIN7, a master switch of xylem vessel differentiation. Plant Cell Physiol., 2015. 56(2): p. 242-54 [PMID:25265867] Kakehi J, et al. Mutations in ribosomal proteins, RPL4 and RACK1, suppress the phenotype of a thermospermine-deficient mutant of Arabidopsis thaliana. PLoS ONE, 2015. 10(1): p. e0117309 [PMID:25625317] Jin J, et al. An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors. Mol. Biol. Evol., 2015. 32(7): p. 1767-73 [PMID:25750178] Li Z, et al. A Transcriptional and Metabolic Framework for Secondary Wall Formation in Arabidopsis. Plant Physiol., 2016. 172(2): p. 1334-1351 [PMID:27566165] de Lucas M, et al. Transcriptional Regulation of Arabidopsis Polycomb Repressive Complex 2 Coordinates Cell-Type Proliferation and Differentiation. Plant Cell, 2016. 28(10): p. 2616-2631 [PMID:27650334] Tan TT, et al. Transcription Factors VND1-VND3 Contribute to Cotyledon Xylem Vessel Formation. Plant Physiol., 2018. 176(1): p. 773-789 [PMID:29133368] Ohashi-Ito K,Iwamoto K,Fukuda H LOB DOMAIN-CONTAINING PROTEIN 15 Positively Regulates Expression of VND7, a Master Regulator of Tracheary Elements. Plant Cell Physiol., 2018. 59(5): p. 989-996 [PMID:29444288]