PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

AT1G65360.1

Common Name

AGL23, T8F5.14

Organism

Arabidopsis thaliana

Taxonomic ID

3702

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis

Family

M-type_MADS

Protein Properties

Length: 226aa MW: 25336.9 Da PI: 9.6685

Description

AGAMOUS-like 23

Gene Model

Gene Model ID	Type	Source	Coding Sequence
AT1G65360.1	genome	TAIR	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	68.5	6.4e-22	19	62	6	49
HHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS SRF-TF 6 ksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49 +sn qvtfskR++g++KKA+E ++LCda++a+i+fs+ gk++ + AT1G65360.1 19 ESNLQVTFSKRKAGLFKKASEFCTLCDAKIAMIVFSPAGKVFSF 62 7899*************************************988 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00432	1.3E-31	6	65	IPR002100	Transcription factor, MADS-box
PROSITE profile	PS50066	24.095	6	66	IPR002100	Transcription factor, MADS-box
SuperFamily	SSF55455	2.22E-25	7	89	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	1.3E-18	8	28	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	1.1E-23	16	62	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	1.3E-18	28	43	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	1.3E-18	43	64	IPR002100	Transcription factor, MADS-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0009553	Biological Process	embryo sac development
GO:0009658	Biological Process	chloroplast organization
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Plant Ontology ? help Back to Top
PO Term	PO Category	PO Description
PO:0009009	anatomy	plant embryo
PO:0009025	anatomy	vascular leaf
PO:0009032	anatomy	petal
PO:0009089	anatomy	endosperm
PO:0020030	anatomy	cotyledon
PO:0020038	anatomy	petiole
PO:0020090	anatomy	embryo sac central cell
PO:0020100	anatomy	hypocotyl
PO:0025074	anatomy	embryo sac
PO:0001054	developmental stage	vascular leaf senescent stage
PO:0004507	developmental stage	plant embryo bilateral stage
PO:0007064	developmental stage	LP.12 twelve leaves visible stage
PO:0007115	developmental stage	LP.04 four leaves visible stage
PO:0007123	developmental stage	LP.06 six leaves visible stage
PO:0007611	developmental stage	petal differentiation and expansion stage

Sequence ? help Back to Top
Protein Sequence Length: 226 aa Download sequence Send to blast
MVKKTLGRRK VEIVKMTKES NLQVTFSKRK AGLFKKASEF CTLCDAKIAM IVFSPAGKVF 60 SFGHPNVDVL LDHFRGCVVG HNNTNLDESY TKLHVQMLNK SYTEVKAEVE KEQKNKQSRA 120 QNERENENAE EWWSKSPLEL NLSQSTCMIR VLKDLKKIVD EKAIQLIHQT NPNFYVGSSS 180 NAAAPATVSG GNISTNQGFF DQNGMTTNPT QTLLFGFDIM NRTPGV

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
6byy_A	1e-15	6	87	1	83	MEF2 CHIMERA
6byy_B	1e-15	6	87	1	83	MEF2 CHIMERA
6byy_C	1e-15	6	87	1	83	MEF2 CHIMERA
6byy_D	1e-15	6	87	1	83	MEF2 CHIMERA
Search in ModeBase

Expression -- Microarray ? help Back to Top
Source	ID	E-value
GEO	18408263	0.0
Genevisible	264182_at	0.0
Expression Atlas	AT1G65360	-
AtGenExpress	AT1G65360	-
ATTED-II	AT1G65360	-

Expression -- Description ? help Back to Top
Source	Description
Uniprot	DEVELOPMENTAL STAGE: During embryo development, expressed in the functional megaspore until maturity of the embryo sac. After fertilization, expressed in the embryo and endosperm until the early torpedo stage. Not expressed in mature embryo. {ECO:0000269\|PubMed:18346189}.

Functional Description ? help Back to Top
Source	Description
TAIR	Encodes AGL23, a Type I MADS-box gene that controls female gametophyte development and the biogenesis of organelles during embryo development.
UniProt	Probable transcription factor that controls female gametophyte (megagametogenesis) development and chloroplast biogenesis during embryo development. {ECO:0000269\|PubMed:18346189}.

Function -- GeneRIF ? help Back to Top
AGL23 is involved in controlling the biogenesis of chloroplasts during embryo development. [PMID: 18346189]

Cis-element ? help Back to Top
Source	Link
PlantRegMap	AT1G65360.1

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Interaction ? help Back to Top
Source	Intact With
IntAct	Search O80807

Phenotype -- Disruption Phenotype ? help Back to Top
Source	Description
UniProt	DISRUPTION PHENOTYPE: Embryonic lethality when homozygous. {ECO:0000269\|PubMed:18346189}.

Phenotype -- Mutation ? help Back to Top
Source	ID
T-DNA Express	AT1G65360

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AY141230	0.0	AY141230.1 Arabidopsis thaliana MADS-box protein AGL23 mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	NP_176715.1	1e-170	AGAMOUS-like 23
Swissprot	O80807	1e-171	AGL23_ARATH; Agamous-like MADS-box protein AGL23
TrEMBL	A0A178WCT9	1e-149	A0A178WCT9_ARATH; AGL23
STRING	AT1G65360.1	1e-169	(Arabidopsis thaliana)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM17507	7	10
Representative plant	OGRP16	17	761

Link Out ? help Back to Top
Phytozome	AT1G65360.1
Entrez Gene	842846
iHOP	AT1G65360
wikigenes	AT1G65360

Publications ? help Back to Top
Riechmann JL, et al. Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes. Science, 2000. 290(5499): p. 2105-10 [PMID:11118137] Shepard KA,Purugganan MD Molecular population genetics of the Arabidopsis CLAVATA2 region. The genomic scale of variation and selection in a selfing species. Genetics, 2003. 163(3): p. 1083-95 [PMID:12663546] De Bodt S, et al. Genomewide structural annotation and evolutionary analysis of the type I MADS-box genes in plants. J. Mol. Evol., 2003. 56(5): p. 573-86 [PMID:12698294] Parenicová L, et al. Molecular and phylogenetic analyses of the complete MADS-box transcription factor family in Arabidopsis: new openings to the MADS world. Plant Cell, 2003. 15(7): p. 1538-51 [PMID:12837945] Kofuji R, et al. Evolution and divergence of the MADS-box gene family based on genome-wide expression analyses. Mol. Biol. Evol., 2003. 20(12): p. 1963-77 [PMID:12949148] Yamada K, et al. Empirical analysis of transcriptional activity in the Arabidopsis genome. Science, 2003. 302(5646): p. 842-6 [PMID:14593172] de Folter S, et al. Comprehensive interaction map of the Arabidopsis MADS Box transcription factors. Plant Cell, 2005. 17(5): p. 1424-33 [PMID:15805477] Pina C,Pinto F,Feij Gene family analysis of the Arabidopsis pollen transcriptome reveals biological implications for cell growth, division control, and gene expression regulation. Plant Physiol., 2005. 138(2): p. 744-56 [PMID:15908605] Colombo M, et al. AGL23, a type I MADS-box gene that controls female gametophyte and embryo development in Arabidopsis. Plant J., 2008. 54(6): p. 1037-48 [PMID:18346189] Day RC,Herridge RP,Ambrose BA,Macknight RC Transcriptome analysis of proliferating Arabidopsis endosperm reveals biological implications for the control of syncytial division, cytokinin signaling, and gene expression regulation. Plant Physiol., 2008. 148(4): p. 1964-84 [PMID:18923020] Bemer M,Heijmans K,Airoldi C,Davies B,Angenent GC An atlas of type I MADS box gene expression during female gametophyte and seed development in Arabidopsis. Plant Physiol., 2010. 154(1): p. 287-300 [PMID:20631316] Tamura K,Fukao Y,Iwamoto M,Haraguchi T,Hara-Nishimura I Identification and characterization of nuclear pore complex components in Arabidopsis thaliana. Plant Cell, 2010. 22(12): p. 4084-97 [PMID:21189294] Willmann MR,Mehalick AJ,Packer RL,Jenik PD MicroRNAs regulate the timing of embryo maturation in Arabidopsis. Plant Physiol., 2011. 155(4): p. 1871-84 [PMID:21330492] Zhang S, et al. FERTILIZATION-INDEPENDENT SEED-Polycomb Repressive Complex 2 Plays a Dual Role in Regulating Type I MADS-Box Genes in Early Endosperm Development. Plant Physiol., 2018. 177(1): p. 285-299 [PMID:29523711]