PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

AT1G52880.1

Common Name

ANAC018, ATNAM, F14G24.15, NAC018, NAM, NARS2

Organism

Arabidopsis thaliana

Taxonomic ID

3702

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis

Family

NAC

Protein Properties

Length: 320aa MW: 35442.7 Da PI: 8.5708

Description

NAC family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
AT1G52880.1	genome	TAIR	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NAM	170.1	7.1e-53	17	146	1	128
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk... 95 lppGfrFhPtdeelv +yLk+k+++ +l++ +i++vd+yk++Pw+Lp+k++ +e+ewyfFs+rd+ky++g r+nra++sgyWkatg+dk+v+s+ AT1G52880.1 17 LPPGFRFHPTDEELVIHYLKRKADSVPLPV-AIIADVDLYKFDPWELPAKASFGEQEWYFFSPRDRKYPNGARPNRAATSGYWKATGTDKPVISTggg 113 79**************************.88***********999999************************************9998 PP NAM 96 kgelvglkktLvfykgrapkgektdWvmheyrl 128 ++++vg+kk Lvfy+g+ pkg+k+dW+mheyrl AT1G52880.1 114 GSKKVGVKKALVFYSGKPPKGVKSDWIMHEYRL 146 8899*************************98 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SuperFamily	SSF101941	4.97E-65	12	178	IPR003441	NAC domain
PROSITE profile	PS51005	61.907	17	177	IPR003441	NAC domain
Pfam	PF02365	1.2E-27	18	146	IPR003441	NAC domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0045995	Biological Process	regulation of embryonic development
GO:0048317	Biological Process	seed morphogenesis
GO:0080060	Biological Process	integument development
GO:0005634	Cellular Component	nucleus
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0044212	Molecular Function	transcription regulatory region DNA binding

Plant Ontology ? help Back to Top
PO Term	PO Category	PO Description
PO:0000013	anatomy	cauline leaf
PO:0000084	anatomy	plant sperm cell
PO:0000230	anatomy	inflorescence meristem
PO:0000293	anatomy	guard cell
PO:0008019	anatomy	leaf lamina base
PO:0009005	anatomy	root
PO:0009006	anatomy	shoot system
PO:0009009	anatomy	plant embryo
PO:0009010	anatomy	seed
PO:0009025	anatomy	vascular leaf
PO:0009029	anatomy	stamen
PO:0009030	anatomy	carpel
PO:0009031	anatomy	sepal
PO:0009032	anatomy	petal
PO:0009046	anatomy	flower
PO:0009047	anatomy	stem
PO:0009052	anatomy	flower pedicel
PO:0020030	anatomy	cotyledon
PO:0020100	anatomy	hypocotyl
PO:0020137	anatomy	leaf apex
PO:0025022	anatomy	collective leaf structure
PO:0025281	anatomy	pollen
PO:0001054	developmental stage	vascular leaf senescent stage
PO:0001078	developmental stage	plant embryo cotyledonary stage
PO:0001081	developmental stage	mature plant embryo stage
PO:0001185	developmental stage	plant embryo globular stage
PO:0007064	developmental stage	LP.12 twelve leaves visible stage
PO:0007095	developmental stage	LP.08 eight leaves visible stage
PO:0007098	developmental stage	LP.02 two leaves visible stage
PO:0007103	developmental stage	LP.10 ten leaves visible stage
PO:0007115	developmental stage	LP.04 four leaves visible stage
PO:0007123	developmental stage	LP.06 six leaves visible stage
PO:0007611	developmental stage	petal differentiation and expansion stage
PO:0007616	developmental stage	flowering stage

Sequence ? help Back to Top
Protein Sequence Length: 320 aa Download sequence Send to blast
MESTDSSGGP PPPQPNLPPG FRFHPTDEEL VIHYLKRKAD SVPLPVAIIA DVDLYKFDPW 60 ELPAKASFGE QEWYFFSPRD RKYPNGARPN RAATSGYWKA TGTDKPVIST GGGGSKKVGV 120 KKALVFYSGK PPKGVKSDWI MHEYRLTDNK PTHICDFGNK KNSLRLDDWV LCRIYKKNNS 180 TASRHHHHLH HIHLDNDHHR HDMMIDDDRF RHVPPGLHFP AIFSDNNDPT AIYDGGGGGY 240 GGGSYSMNHC FASGSKQEQL FPPVMMMTSL NQDSGIGSSS SPSKRFNGGG VGDCSTSMAA 300 TPLMQNQGGI YQLPGLNWYS

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
3ulx_A	6e-73	16	180	14	171	Stress-induced transcription factor NAC1
Search in ModeBase

Expression -- UniGene ? help Back to Top
UniGene ID	E-value	Expressed in
At.11024	0.0	flower\| leaf\| seed\| silique

Expression -- Microarray ? help Back to Top
Source	ID	E-value
GEO	30695367	0.0
Genevisible	260156_at	0.0
Expression Atlas	AT1G52880	-
AtGenExpress	AT1G52880	-
ATTED-II	AT1G52880	-

Expression -- Description ? help Back to Top
Source	Description
Uniprot	TISSUE SPECIFICITY: Restricted primarily to the region of the embryo including the SAM (PubMed:12175016). Expressed in the outer integument, but seems not expressed in the embryo at the torpedo stage (PubMed:18849494). {ECO:0000269\|PubMed:12175016, ECO:0000269\|PubMed:18849494}.

Functional Description ? help Back to Top
Source	Description
TAIR	Transcription factor with a NAC domain. Homologous to the petunia gene NAM which is required for the development of the shoot. Expressed in the embryo.
UniProt	May encode a transcription factor involved in the elaboration of shoot apical meristems (SAM) (Probable). Together with NAC056/NARS1, regulates embryogenesis by regulating the development and degeneration of ovule integuments, a process required for intertissue communication between the embryo and the maternal integument (PubMed:18849494). {ECO:0000269\|PubMed:18849494, ECO:0000305}.

Function -- GeneRIF ? help Back to Top
NARS1/NAC2 and NARS2/NAM regulate embryogenesis by regulating the development and degeneration of ovule integuments. [PMID: 18849494]

Binding Motif ? help Back to Top
Motif ID	Method	Source	Motif file
MP00201	DAP	27203113	Download

Cis-element ? help Back to Top
Source	Link
PlantRegMap	AT1G52880.1

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	Retrieve

Regulation -- ATRM (Manually Curated Upstream Regulators) ? help Back to Top
Source	Upstream Regulator (A: Activate/R: Repress)
ATRM	AT5G61850 (A)

Regulation -- ATRM (Manually Curated Target Genes) ? help Back to Top
Source	Target Gene (A: Activate/R: Repress)
ATRM	AT5G61850(A)

Interaction ? help Back to Top
Source	Intact With
BioGRID	AT1G53170, AT1G77450

Phenotype -- Disruption Phenotype ? help Back to Top
Source	Description
UniProt	DISRUPTION PHENOTYPE: When associated with disruption in NAC056/NARS1, abnormally shaped seeds, defect in embryogenesis arrested at the torpedo-shaped embryo stage, markedly delayed integuments degeneration, and delay of silique senescence. {ECO:0000269\|PubMed:18849494}.

Phenotype -- Mutation ? help Back to Top
Source	ID
T-DNA Express	AT1G52880

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AF123311	0.0	AF123311.1 Arabidopsis thaliana NAC domain protein NAM mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	NP_175696.1	0.0	NAC (No Apical Meristem) domain transcriptional regulator superfamily protein
Swissprot	Q9ZNU2	0.0	NAC18_ARATH; NAC domain-containing protein 18
TrEMBL	A0A178W6K4	0.0	A0A178W6K4_ARATH; NARS2
STRING	AT1G52880.1	0.0	(Arabidopsis thaliana)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM190	28	276
Representative plant	OGRP17	15	800

Link Out ? help Back to Top
Phytozome	AT1G52880.1
Entrez Gene	841721
iHOP	AT1G52880
wikigenes	AT1G52880

Publications ? help Back to Top
Kikuchi K, et al. Molecular analysis of the NAC gene family in rice. Mol. Gen. Genet., 2000. 262(6): p. 1047-51 [PMID:10660065] Riechmann JL, et al. Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes. Science, 2000. 290(5499): p. 2105-10 [PMID:11118137] Duval M,Hsieh TF,Kim SY,Thomas TL Molecular characterization of AtNAM: a member of the Arabidopsis NAC domain superfamily. Plant Mol. Biol., 2002. 50(2): p. 237-48 [PMID:12175016] Xie Q, et al. SINAT5 promotes ubiquitin-related degradation of NAC1 to attenuate auxin signals. Nature, 2002. 419(6903): p. 167-70 [PMID:12226665] Yamada K, et al. Empirical analysis of transcriptional activity in the Arabidopsis genome. Science, 2003. 302(5646): p. 842-6 [PMID:14593172] Ooka H, et al. Comprehensive analysis of NAC family genes in Oryza sativa and Arabidopsis thaliana. DNA Res., 2003. 10(6): p. 239-47 [PMID:15029955] Zimmermann R,Werr W Pattern formation in the monocot embryo as revealed by NAM and CUC3 orthologues from Zea mays L. Plant Mol. Biol., 2005. 58(5): p. 669-85 [PMID:16158242] Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Kim YS, et al. A membrane-bound NAC transcription factor regulates cell division in Arabidopsis. Plant Cell, 2006. 18(11): p. 3132-44 [PMID:17098812] Zhong R,Demura T,Ye ZH SND1, a NAC domain transcription factor, is a key regulator of secondary wall synthesis in fibers of Arabidopsis. Plant Cell, 2006. 18(11): p. 3158-70 [PMID:17114348] Demura T,Fukuda H Transcriptional regulation in wood formation. Trends Plant Sci., 2007. 12(2): p. 64-70 [PMID:17224301] Ascencio-Ib Global analysis of Arabidopsis gene expression uncovers a complex array of changes impacting pathogen response and cell cycle during geminivirus infection. Plant Physiol., 2008. 148(1): p. 436-54 [PMID:18650403] Kunieda T, et al. NAC family proteins NARS1/NAC2 and NARS2/NAM in the outer integument regulate embryogenesis in Arabidopsis. Plant Cell, 2008. 20(10): p. 2631-42 [PMID:18849494] Blein T, et al. A conserved molecular framework for compound leaf development. Science, 2008. 322(5909): p. 1835-9 [PMID:19095941] Yoshiyama K,Conklin PA,Huefner ND,Britt AB Suppressor of gamma response 1 (SOG1) encodes a putative transcription factor governing multiple responses to DNA damage. Proc. Natl. Acad. Sci. U.S.A., 2009. 106(31): p. 12843-8 [PMID:19549833] Kim SG,Park CM Membrane-mediated salt stress signaling in flowering time control. Plant Signal Behav, 2007. 2(6): p. 517-8 [PMID:19704545] Yabuta Y, et al. Identification of recognition sequence of ANAC078 protein by the cyclic amplification and selection of targets technique. Plant Signal Behav, 2010. 5(6): p. 695-7 [PMID:20404498] Wang H, et al. Mutation of WRKY transcription factors initiates pith secondary wall formation and increases stem biomass in dicotyledonous plants. Proc. Natl. Acad. Sci. U.S.A., 2010. 107(51): p. 22338-43 [PMID:21135241] Gaudinier A, et al. Enhanced Y1H assays for Arabidopsis. Nat. Methods, 2011. 8(12): p. 1053-5 [PMID:22037706] Lee S,Park CM Regulation of reactive oxygen species generation under drought conditions in Arabidopsis. Plant Signal Behav, 2012. 7(6): p. 599-601 [PMID:22580707] Li J, et al. miRNA164-directed cleavage of ZmNAC1 confers lateral root development in maize (Zea mays L.). BMC Plant Biol., 2012. 12: p. 220 [PMID:23171309] Singh AK,Sharma V,Pal AK,Acharya V,Ahuja PS Genome-wide organization and expression profiling of the NAC transcription factor family in potato (Solanum tuberosum L.). DNA Res., 2013. 20(4): p. 403-23 [PMID:23649897] Wei H,Yordanov YS,Georgieva T,Li X,Busov V Nitrogen deprivation promotes Populus root growth through global transcriptome reprogramming and activation of hierarchical genetic networks. New Phytol., 2013. 200(2): p. 483-97 [PMID:23795675] Wang YX Characterization of a novel Medicago sativa NAC transcription factor gene involved in response to drought stress. Mol. Biol. Rep., 2013. 40(11): p. 6451-8 [PMID:24057250] Lumba S, et al. A mesoscale abscisic acid hormone interactome reveals a dynamic signaling landscape in Arabidopsis. Dev. Cell, 2014. 29(3): p. 360-72 [PMID:24823379] Raherison ES,Giguère I,Caron S,Lamara M,MacKay JJ Modular organization of the white spruce (Picea glauca) transcriptome reveals functional organization and evolutionary signatures. New Phytol., 2015. 207(1): p. 172-87 [PMID:25728802] Jin J, et al. An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors. Mol. Biol. Evol., 2015. 32(7): p. 1767-73 [PMID:25750178] Du Q,Wang H The role of HD-ZIP III transcription factors and miR165/166 in vascular development and secondary cell wall formation. Plant Signal Behav, 2015. 10(10): p. e1078955 [PMID:26340415] Vialette-Guiraud AC, et al. A Conserved Role for the NAM/miR164 Developmental Module Reveals a Common Mechanism Underlying Carpel Margin Fusion in Monocarpous and Syncarpous Eurosids. Front Plant Sci, 2015. 6: p. 1239 [PMID:26793217] Aida M,Ishida T,Fukaki H,Fujisawa H,Tasaka M Genes involved in organ separation in Arabidopsis: an analysis of the cup-shaped cotyledon mutant. Plant Cell, 1997. 9(6): p. 841-57 [PMID:9212461]