PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | AT1G31140.1 | ||||||||
Common Name | AGL63, GOA | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 213aa MW: 24931.6 Da PI: 9.9921 | ||||||||
Description | GORDITA | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 75 | 6.1e-24 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 k+ie+k++rqvtf+kR++ ++KKA+ELSvLCd+ +iifs++++ly+++s AT1G31140.1 9 KKIEEKIKRQVTFAKRKKSLIKKAYELSVLCDVHLGLIIFSHSNRLYDFCS 59 68***********************************************96 PP | |||||||
2 | K-box | 30.8 | 1.2e-11 | 94 | 155 | 20 | 81 |
K-box 20 elakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelq 81 + + +eienL+ ++ + G +L+ L++ eL + e +Le+sl++ R++K+e++++q +++ AT1G31140.1 94 TKESMMREIENLKLNLQLYDGHGLNLLTYDELLSFELHLESSLQHARARKSEFMHQQQQQQT 155 4567889***********************************************99876543 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00432 | 1.3E-27 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS50066 | 25.034 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 1.14E-24 | 1 | 76 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 5.44E-35 | 2 | 78 | No hit | No description |
PRINTS | PR00404 | 7.4E-22 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 5.6E-22 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 7.4E-22 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 7.4E-22 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS51297 | 9.721 | 88 | 176 | IPR002487 | Transcription factor, K-box |
Pfam | PF01486 | 1.9E-6 | 95 | 156 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0030308 | Biological Process | negative regulation of cell growth | ||||
GO:0048510 | Biological Process | regulation of timing of transition from vegetative to reproductive phase | ||||
GO:0048530 | Biological Process | fruit morphogenesis | ||||
GO:0080060 | Biological Process | integument development | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0005515 | Molecular Function | protein binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Plant Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PO Term | PO Category | PO Description | ||||
PO:0000013 | anatomy | cauline leaf | ||||
PO:0000014 | anatomy | rosette leaf | ||||
PO:0009001 | anatomy | fruit | ||||
PO:0009009 | anatomy | plant embryo | ||||
PO:0009046 | anatomy | flower |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 213 aa Download sequence Send to blast |
MRKGKRVIKK IEEKIKRQVT FAKRKKSLIK KAYELSVLCD VHLGLIIFSH SNRLYDFCSN 60 STSMENLIMR YQKEKEGQTT AEHSFHSCSD CVKTKESMMR EIENLKLNLQ LYDGHGLNLL 120 TYDELLSFEL HLESSLQHAR ARKSEFMHQQ QQQQTDQKLK GKEKGQGSSW EQLMWQAERQ 180 MMTCQRQKDP APANEGGVPF LRWGTTHRRS SPP |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1n6j_A | 1e-14 | 8 | 76 | 7 | 73 | Myocyte-specific enhancer factor 2B |
1n6j_B | 1e-14 | 8 | 76 | 7 | 73 | Myocyte-specific enhancer factor 2B |
1tqe_P | 1e-14 | 8 | 76 | 8 | 74 | Myocyte-specific enhancer factor 2B |
1tqe_Q | 1e-14 | 8 | 76 | 8 | 74 | Myocyte-specific enhancer factor 2B |
1tqe_R | 1e-14 | 8 | 76 | 8 | 74 | Myocyte-specific enhancer factor 2B |
1tqe_S | 1e-14 | 8 | 76 | 8 | 74 | Myocyte-specific enhancer factor 2B |
6c9l_A | 1e-14 | 8 | 76 | 8 | 74 | Myocyte-specific enhancer factor 2B |
6c9l_B | 1e-14 | 8 | 76 | 8 | 74 | Myocyte-specific enhancer factor 2B |
6c9l_C | 1e-14 | 8 | 76 | 8 | 74 | Myocyte-specific enhancer factor 2B |
6c9l_D | 1e-14 | 8 | 76 | 8 | 74 | Myocyte-specific enhancer factor 2B |
6c9l_E | 1e-14 | 8 | 76 | 8 | 74 | Myocyte-specific enhancer factor 2B |
6c9l_F | 1e-14 | 8 | 76 | 8 | 74 | Myocyte-specific enhancer factor 2B |
Search in ModeBase |
Expression -- Microarray ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | |||||
Expression Atlas | AT1G31140 | |||||
AtGenExpress | AT1G31140 |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in bud pedicels, petals, anthers, style, ovary, seeds and embryos. {ECO:0000269|PubMed:20088901, ECO:0000269|PubMed:20598091}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
TAIR | Encodes a B-sister MADS-box protein, GORDITA which is specific to the Brassicaceae. GOA is the most closely related paralog of ABS. GOA represses fruit growth and contributes to integument development. Over-expression of GOA results in disorganized floral structure and addition of carpel-like features to sepals. | |||||
UniProt | Probable transcription factor involved in the regulation of fruit growth. Contributes to integument development. Controls organ size via cell expansion (PubMed:20088901). Involved in the regulation of longitudinal growth of the fruit evenly throughout the radial axis (PubMed:20598091). Functions redundantly with TT16/AGL32 to repress nucellus growth and promote its degeneration (PubMed:27233529). {ECO:0000269|PubMed:20088901, ECO:0000269|PubMed:20598091, ECO:0000269|PubMed:27233529}. |
Function -- GeneRIF ? help Back to Top | ||||||
---|---|---|---|---|---|---|
|
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00172 | DAP | 27203113 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | AT1G31140.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Phenotype -- Mutation ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | |||||
T-DNA Express | AT1G31140 |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AY141243 | 0.0 | AY141243.1 Arabidopsis thaliana MADS-box protein AGL63 mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_174399.2 | 1e-159 | GORDITA | ||||
Swissprot | Q9SA07 | 1e-154 | AGL63_ARATH; Agamous-like MADS-box protein AGL63 | ||||
TrEMBL | A0A178W639 | 1e-151 | A0A178W639_ARATH; GOA | ||||
STRING | AT1G31140.2 | 1e-152 | (Arabidopsis thaliana) |
Link Out ? help Back to Top | |
---|---|
Phytozome | AT1G31140.1 |
Entrez Gene | 839999 |
iHOP | AT1G31140 |
wikigenes | AT1G31140 |