PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | AT1G29962.1 | ||||||||
Common Name | AGL64 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
|
||||||||
Family | M-type_MADS | ||||||||
Protein Properties | Length: 185aa MW: 21176.3 Da PI: 9.3641 | ||||||||
Description | AGAMOUS-like 64 | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 51.2 | 1.6e-16 | 15 | 64 | 1 | 50 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50 k+ie + r vt+skRrngi K +ELS+LC+aeva + +s +gk y++ AT1G29962.1 15 KKIEKDEDRLVTLSKRRNGIYTKLSELSILCGAEVAFLGYSCSGKPYTFG 64 689*********************************************95 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00432 | 2.4E-19 | 7 | 66 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 2.88E-22 | 7 | 77 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS50066 | 21.824 | 7 | 67 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 1.02E-31 | 8 | 80 | No hit | No description |
PRINTS | PR00404 | 7.0E-15 | 9 | 29 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 8.3E-19 | 16 | 63 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 7.0E-15 | 29 | 44 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 7.0E-15 | 44 | 65 | IPR002100 | Transcription factor, MADS-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Plant Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PO Term | PO Category | PO Description | ||||
PO:0009009 | anatomy | plant embryo | ||||
PO:0009089 | anatomy | endosperm | ||||
PO:0020093 | anatomy | antipodal cell |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 185 aa Download sequence Send to blast |
MKPKKTKGKQ RINIKKIEKD EDRLVTLSKR RNGIYTKLSE LSILCGAEVA FLGYSCSGKP 60 YTFGSPSFQA VAERFLNGEA SSSSSSSLQR SVMNAHQQAK IQELCKVYNR LVEEITVEEV 120 KLKKTAALAE MMPMNEDAWW KVDPNDVKDR EEVKKMMEKH QELYEKLCEE AASRIKRGHD 180 ENNNK |
Expression -- Microarray ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | E-value | ||||
Genevisible | 260050_at | 0.0 | ||||
Expression Atlas | AT1G29962 | - | ||||
AtGenExpress | AT1G29962 | - |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | AT1G29962.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Phenotype -- Mutation ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | |||||
T-DNA Express | AT1G29962 |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AC022455 | 0.0 | AC022455.5 Arabidopsis thaliana chromosome 1 BAC T1P2 genomic sequence, complete sequence. | |||
GenBank | AY141244 | 0.0 | AY141244.1 Arabidopsis thaliana MADS-box protein AGL64 mRNA, complete cds. | |||
GenBank | CP002684 | 0.0 | CP002684.1 Arabidopsis thaliana chromosome 1 sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_001077625.1 | 1e-136 | AGAMOUS-like 64 | ||||
TrEMBL | Q7XJK9 | 1e-135 | Q7XJK9_ARATH; AGAMOUS-like 64 | ||||
STRING | AT1G29962.1 | 1e-135 | (Arabidopsis thaliana) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM4676 | 13 | 52 | Representative plant | OGRP16 | 17 | 761 |
Link Out ? help Back to Top | |
---|---|
Phytozome | AT1G29962.1 |
Entrez Gene | 5007741 |
iHOP | AT1G29962 |
wikigenes | AT1G29962 |
Publications ? help Back to Top | |||
---|---|---|---|
|