PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

AT1G26310.1

Common Name

AGL10, CAL, CAL1, F28B23.24

Organism

Arabidopsis thaliana

Taxonomic ID

3702

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis

Family

MIKC_MADS

Protein Properties

Length: 255aa MW: 30187.4 Da PI: 8.3045

Description

MIKC_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
AT1G26310.1	genome	TAIR	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	95.7	2e-30	9	59	1	51
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krienk+nrqvtfskRr+g+lKKA+E+SvLCdaev++i+fs++gkl+eyss AT1G26310.1 9 KRIENKINRQVTFSKRRTGLLKKAQEISVLCDAEVSLIVFSHKGKLFEYSS 59 79***********************************************96 PP
2	K-box	104.3	1.5e-34	85	176	9	100
K-box 9 leeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkklee 100 + + + +++ e+++Lk++ie L+r+qRh+lGe+Le++slk+Lq+LeqqLe++lk+iRs+Kn+l+ e++++lq+keke+qeen +L+k+++e AT1G26310.1 85 SHVNAQTNWSMEYSRLKAKIELLERNQRHYLGEELEPMSLKDLQNLEQQLETALKHIRSRKNQLMNESLNHLQRKEKEIQEENSMLTKQIKE 176 55667899*********************************************************************************987 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS50066	32.142	1	61	IPR002100	Transcription factor, MADS-box
SMART	SM00432	1.7E-39	1	60	IPR002100	Transcription factor, MADS-box
SuperFamily	SSF55455	9.68E-34	2	85	IPR002100	Transcription factor, MADS-box
CDD	cd00265	1.79E-41	2	79	No hit	No description
PRINTS	PR00404	1.4E-30	3	23	IPR002100	Transcription factor, MADS-box
PROSITE pattern	PS00350	0	3	57	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	1.2E-24	10	57	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	1.4E-30	23	38	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	1.4E-30	38	59	IPR002100	Transcription factor, MADS-box
Pfam	PF01486	3.9E-30	85	174	IPR002487	Transcription factor, K-box
PROSITE profile	PS51297	17.22	90	180	IPR002487	Transcription factor, K-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0009911	Biological Process	positive regulation of flower development
GO:0010582	Biological Process	floral meristem determinacy
GO:0030154	Biological Process	cell differentiation
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0005515	Molecular Function	protein binding
GO:0046983	Molecular Function	protein dimerization activity

Plant Ontology ? help Back to Top
PO Term	PO Category	PO Description
PO:0000037	anatomy	shoot apex
PO:0009005	anatomy	root
PO:0009009	anatomy	plant embryo
PO:0009010	anatomy	seed
PO:0009029	anatomy	stamen
PO:0009030	anatomy	carpel
PO:0009031	anatomy	sepal
PO:0009032	anatomy	petal
PO:0009046	anatomy	flower
PO:0009052	anatomy	flower pedicel
PO:0020100	anatomy	hypocotyl
PO:0025022	anatomy	collective leaf structure
PO:0001078	developmental stage	plant embryo cotyledonary stage
PO:0001081	developmental stage	mature plant embryo stage
PO:0004507	developmental stage	plant embryo bilateral stage
PO:0007611	developmental stage	petal differentiation and expansion stage
PO:0007616	developmental stage	flowering stage

Sequence ? help Back to Top
Protein Sequence Length: 255 aa Download sequence Send to blast
MGRGRVELKR IENKINRQVT FSKRRTGLLK KAQEISVLCD AEVSLIVFSH KGKLFEYSSE 60 SCMEKVLERY ERYSYAERQL IAPDSHVNAQ TNWSMEYSRL KAKIELLERN QRHYLGEELE 120 PMSLKDLQNL EQQLETALKH IRSRKNQLMN ESLNHLQRKE KEIQEENSML TKQIKERENI 180 LRTKQTQCEQ LNRSVDDVPQ PQPFQHPHLY MIAHQTSPFL NMGGLYQEED QTAMRRNNLD 240 LTLEPIYNYL GCYAA

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
6byy_A	1e-20	1	74	1	73	MEF2 CHIMERA
6byy_B	1e-20	1	74	1	73	MEF2 CHIMERA
6byy_C	1e-20	1	74	1	73	MEF2 CHIMERA
6byy_D	1e-20	1	74	1	73	MEF2 CHIMERA
6bz1_A	1e-20	1	74	1	73	MEF2 CHIMERA
6bz1_B	1e-20	1	74	1	73	MEF2 CHIMERA
6bz1_C	1e-20	1	74	1	73	MEF2 CHIMERA
6bz1_D	1e-20	1	74	1	73	MEF2 CHIMERA
Search in ModeBase

Expression -- Microarray ? help Back to Top
Source	ID	E-value
Genevisible	245819_at	0.0
Expression Atlas	AT1G26310	-
AtGenExpress	AT1G26310	-
ATTED-II	AT1G26310	-

Expression -- Description ? help Back to Top
Source	Description
Uniprot	DEVELOPMENTAL STAGE: Expressed at an early stage of floral initiation.
Uniprot	TISSUE SPECIFICITY: Expressed in young flower primordia.

Functional Description ? help Back to Top
Source	Description
TAIR	Floral homeotic gene encoding a MADS domain protein homologous to AP1. Enhances the flower to shoot transformation in ap1 mutants.
UniProt	Probable transcription factor that promotes early floral meristem identity in synergy with APETALA1, FRUITFULL and LEAFY. Is required subsequently for the transition of an inflorescence meristem into a floral meristem. Seems to be partially redundant to the function of APETALA1. Positively regulates the APETALA1 and LEAFY expression. {ECO:0000269\|PubMed:10648231, ECO:0000269\|Ref.6}.

Function -- GeneRIF ? help Back to Top
Expression of the transcription factor CAL is activated by LFY and the meristem identity regulator LMI1. [PMID: 16554366] The unique and redundant functions of the APETALA1 and CAULIFLOWER genes have been mapped to the four protein domains that characterize type-II MADS-domain proteins. [PMID: 16893974] the differences between the Arabidopsis (Arabidopsis thaliana) APETALA1 (AP1) and CAULIFLOWER (CAL) duplicate genes in the time, space, and level of expression were determined by the presence or absence of functionally important transcription factor-binding sites (TFBSs) in regulatory regions. [PMID: 27208240] LFY and AP1/CAL act as part of an incoherent feed-forward loop, a network motif where two interconnected pathways or transcription factors act in opposite directions on a target gene, to control the establishment of a stable developmental program for the formation of flowers. [PMID: 28385730]

Cis-element ? help Back to Top
Source	Link
PlantRegMap	AT1G26310.1

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	Retrieve

Regulation -- ATRM (Manually Curated Upstream Regulators) ? help Back to Top
Source	Upstream Regulator (A: Activate/R: Repress)
ATRM	AT2G22540 (A), AT2G27990 (A), AT5G02030 (A), AT5G03790 (A), AT5G61850 (A)

Regulation -- ATRM (Manually Curated Target Genes) ? help Back to Top
Source	Target Gene (A: Activate/R: Repress)
ATRM	AT1G69120(A), AT5G03840(R), AT5G61850(A)

Interaction ? help Back to Top
Source	Intact With
BioGRID	AT1G48150
IntAct	Search Q39081

Phenotype -- Mutation ? help Back to Top
Source	ID
T-DNA Express	AT1G26310

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AB493477	0.0	AB493477.1 Arabidopsis thaliana At1g26310 mRNA for hypothetical protein, partial cds, clone: RAAt1g26310.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	NP_564243.1	0.0	K-box region and MADS-box transcription factor family protein
Swissprot	Q39081	0.0	CAL_ARATH; Transcription factor CAULIFLOWER
TrEMBL	A0A178W9U9	0.0	A0A178W9U9_ARATH; CAL1
STRING	AT1G26310.1	0.0	(Arabidopsis thaliana)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM792	25	110
Representative plant	OGRP16	17	761

Link Out ? help Back to Top
Phytozome	AT1G26310.1
Entrez Gene	839172
iHOP	AT1G26310
wikigenes	AT1G26310

Publications ? help Back to Top
Ratcliffe OJ,Bradley DJ,Coen ES Separation of shoot and floral identity in Arabidopsis. Development, 1999. 126(6): p. 1109-20 [PMID:10021331] Aukerman MJ,Lee I,Weigel D,Amasino RM The Arabidopsis flowering-time gene LUMINIDEPENDENS is expressed primarily in regions of cell proliferation and encodes a nuclear protein that regulates LEAFY expression. Plant J., 1999. 18(2): p. 195-203 [PMID:10363371] Liljegren SJ,Gustafson-Brown C,Pinyopich A,Ditta GS,Yanofsky MF Interactions among APETALA1, LEAFY, and TERMINAL FLOWER1 specify meristem fate. Plant Cell, 1999. 11(6): p. 1007-18 [PMID:10368173] Lawton-Rauh AL,Buckler ES,Purugganan MD Patterns of molecular evolution among paralogous floral homeotic genes. Mol. Biol. Evol., 1999. 16(8): p. 1037-45 [PMID:10474900] Lowman AC,Purugganan MD Duplication of the Brassica oleracea APETALA1 floral homeotic gene and the evolution of domesticated cauliflower. J. Hered., 1999 Sep-Oct. 90(5): p. 514-20 [PMID:10544496] Hempel FD,Welch DR,Feldman LJ Floral induction and determination: where is flowering controlled? Trends Plant Sci., 2000. 5(1): p. 17-21 [PMID:10637657] Ferrándiz C,Gu Q,Martienssen R,Yanofsky MF Redundant regulation of meristem identity and plant architecture by FRUITFULL, APETALA1 and CAULIFLOWER. Development, 2000. 127(4): p. 725-34 [PMID:10648231] Purugganan MD,Boyles AL,Suddith JI Variation and selection at the CAULIFLOWER floral homeotic gene accompanying the evolution of domesticated Brassica oleracea. Genetics, 2000. 155(2): p. 855-62 [PMID:10835404] Riechmann JL, et al. Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes. Science, 2000. 290(5499): p. 2105-10 [PMID:11118137] Pelaz S,Gustafson-Brown C,Kohalmi SE,Crosby WL,Yanofsky MF APETALA1 and SEPALLATA3 interact to promote flower development. Plant J., 2001. 26(4): p. 385-94 [PMID:11439126] Munir J,Dorn LA,Donohue K,Schmitt J The effect of maternal photoperiod on seasonal dormancy in Arabidopsis thaliana (Brassicaceae). Am. J. Bot., 2001. 88(7): p. 1240-9 [PMID:11454624] Brendel V,Zhu W Computational modeling of gene structure in Arabidopsis thaliana. Plant Mol. Biol., 2002. 48(1-2): p. 49-58 [PMID:11860212] Olsen KM,Womack A,Garrett AR,Suddith JI,Purugganan MD Contrasting evolutionary forces in the Arabidopsis thaliana floral developmental pathway. Genetics, 2002. 160(4): p. 1641-50 [PMID:11973317] Parenicová L, et al. Molecular and phylogenetic analyses of the complete MADS-box transcription factor family in Arabidopsis: new openings to the MADS world. Plant Cell, 2003. 15(7): p. 1538-51 [PMID:12837945] William DA, et al. Genomic identification of direct target genes of LEAFY. Proc. Natl. Acad. Sci. U.S.A., 2004. 101(6): p. 1775-80 [PMID:14736918] Boss PK,Bastow RM,Mylne JS,Dean C Multiple pathways in the decision to flower: enabling, promoting, and resetting. Plant Cell, 2004. 16 Suppl: p. S18-31 [PMID:15037730] de Folter S, et al. Comprehensive interaction map of the Arabidopsis MADS Box transcription factors. Plant Cell, 2005. 17(5): p. 1424-33 [PMID:15805477] Castillejo C,Romera-Branchat M,Pelaz S A new role of the Arabidopsis SEPALLATA3 gene revealed by its constitutive expression. Plant J., 2005. 43(4): p. 586-96 [PMID:16098111] Saddic LA, et al. The LEAFY target LMI1 is a meristem identity regulator and acts together with LEAFY to regulate expression of CAULIFLOWER. Development, 2006. 133(9): p. 1673-82 [PMID:16554366] Sundström JF,Nakayama N,Glimelius K,Irish VF Direct regulation of the floral homeotic APETALA1 gene by APETALA3 and PISTILLATA in Arabidopsis. Plant J., 2006. 46(4): p. 593-600 [PMID:16640596] Alvarez-Buylla ER,García-Ponce B,Garay-Arroyo A Unique and redundant functional domains of APETALA1 and CAULIFLOWER, two recently duplicated Arabidopsis thaliana floral MADS-box genes. J. Exp. Bot., 2006. 57(12): p. 3099-107 [PMID:16893974] Sablowski R Flowering and determinacy in Arabidopsis. J. Exp. Bot., 2007. 58(5): p. 899-907 [PMID:17293602] Pei Y, et al. Mutations in the Type II protein arginine methyltransferase AtPRMT5 result in pleiotropic developmental defects in Arabidopsis. Plant Physiol., 2007. 144(4): p. 1913-23 [PMID:17573539] Schmidt UG, et al. Novel tonoplast transporters identified using a proteomic approach with vacuoles isolated from cauliflower buds. Plant Physiol., 2007. 145(1): p. 216-29 [PMID:17660356] Kanrar S,Bhattacharya M,Arthur B,Courtier J,Smith HM Regulatory networks that function to specify flower meristems require the function of homeobox genes PENNYWISE and POUND-FOOLISH in Arabidopsis. Plant J., 2008. 54(5): p. 924-37 [PMID:18298668] Gregis V,Sessa A,Colombo L,Kater MM AGAMOUS-LIKE24 and SHORT VEGETATIVE PHASE determine floral meristem identity in Arabidopsis. Plant J., 2008. 56(6): p. 891-902 [PMID:18694458] Hamès C, et al. Structural basis for LEAFY floral switch function and similarity with helix-turn-helix proteins. EMBO J., 2008. 27(19): p. 2628-37 [PMID:18784751] Park W,Zhai J,Lee JY Highly efficient gene silencing using perfect complementary artificial miRNA targeting AP1 or heteromeric artificial miRNA targeting AP1 and CAL genes. Plant Cell Rep., 2009. 28(3): p. 469-80 [PMID:19066901] Skinner DJ,Gasser CS Expression-based discovery of candidate ovule development regulators through transcriptional profiling of ovule mutants. BMC Plant Biol., 2009. 9: p. 29 [PMID:19291320] Kalamaki MS, et al. Over-expression of a tomato N-acetyl-L-glutamate synthase gene (SlNAGS1) in Arabidopsis thaliana results in high ornithine levels and increased tolerance in salt and drought stresses. J. Exp. Bot., 2009. 60(6): p. 1859-71 [PMID:19357433] Hily JM,Singer SD,Yang Y,Liu Z A transformation booster sequence (TBS) from Petunia hybrida functions as an enhancer-blocking insulator in Arabidopsis thaliana. Plant Cell Rep., 2009. 28(7): p. 1095-104 [PMID:19373469] Bertoni G PUCHI and floral meristem identity. Plant Cell, 2009. 21(5): p. 1327 [PMID:19482969] Karim MR,Hirota A,Kwiatkowska D,Tasaka M,Aida M A role for Arabidopsis PUCHI in floral meristem identity and bract suppression. Plant Cell, 2009. 21(5): p. 1360-72 [PMID:19482972] Gregis V,Sessa A,Dorca-Fornell C,Kater MM The Arabidopsis floral meristem identity genes AP1, AGL24 and SVP directly repress class B and C floral homeotic genes. Plant J., 2009. 60(4): p. 626-37 [PMID:19656343] Xu M, et al. Arabidopsis BLADE-ON-PETIOLE1 and 2 promote floral meristem fate and determinacy in a previously undefined pathway targeting APETALA1 and AGAMOUS-LIKE24. Plant J., 2010. 63(6): p. 974-89 [PMID:20626659] Zhou X, et al. The cauliflower Orange gene enhances petiole elongation by suppressing expression of eukaryotic release factor 1. New Phytol., 2011. 190(1): p. 89-100 [PMID:21175633] Yang Y,Karlson DT Overexpression of AtCSP4 affects late stages of embryo development in Arabidopsis. J. Exp. Bot., 2011. 62(6): p. 2079-91 [PMID:21282328] Liu Z, et al. Overexpression of a resveratrol synthase gene (PcRS) from Polygonum cuspidatum in transgenic Arabidopsis causes the accumulation of trans-piceid with antifungal activity. Plant Cell Rep., 2011. 30(11): p. 2027-36 [PMID:21717185] Pogorelko G, et al. Post-synthetic modification of plant cell walls by expression of microbial hydrolases in the apoplast. Plant Mol. Biol., 2011. 77(4-5): p. 433-45 [PMID:21910026] Grandi V,Gregis V,Kater MM Uncovering genetic and molecular interactions among floral meristem identity genes in Arabidopsis thaliana. Plant J., 2012. 69(5): p. 881-93 [PMID:22040363] Chiu LW,Li L Characterization of the regulatory network of BoMYB2 in controlling anthocyanin biosynthesis in purple cauliflower. Planta, 2012. 236(4): p. 1153-64 [PMID:22644767] Tsai AY, et al. Constitutive expression of a fungal glucuronoyl esterase in Arabidopsis reveals altered cell wall composition and structure. Plant Biotechnol. J., 2012. 10(9): p. 1077-87 [PMID:22924998] Takahashi S,Ono M,Uchida A,Nakayama K,Satoh H Molecular cloning and functional expression of a water-soluble chlorophyll-binding protein from Japanese wild radish. J. Plant Physiol., 2013. 170(4): p. 406-12 [PMID:23266282] Jin J, et al. An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors. Mol. Biol. Evol., 2015. 32(7): p. 1767-73 [PMID:25750178] Ye L,Wang B,Zhang W,Shan H,Kong H Gains and Losses of Cis-regulatory Elements Led to Divergence of the Arabidopsis APETALA1 and CAULIFLOWER Duplicate Genes in the Time, Space, and Level of Expression and Regulation of One Paralog by the Other. Plant Physiol., 2016. 171(2): p. 1055-69 [PMID:27208240] Goslin K, et al. Transcription Factor Interplay between LEAFY and APETALA1/CAULIFLOWER during Floral Initiation. Plant Physiol., 2017. 174(2): p. 1097-1109 [PMID:28385730] Smyth DR Flower development. Origin of the cauliflower. Curr. Biol., 1995. 5(4): p. 361-3 [PMID:7627548] Kempin SA,Savidge B,Yanofsky MF Molecular basis of the cauliflower phenotype in Arabidopsis. Science, 1995. 267(5197): p. 522-5 [PMID:7824951] Ruiz-García L, et al. Different roles of flowering-time genes in the activation of floral initiation genes in Arabidopsis. Plant Cell, 1997. 9(11): p. 1921-34 [PMID:9401118] Chen L,Cheng JC,Castle L,Sung ZR EMF genes regulate Arabidopsis inflorescence development. Plant Cell, 1997. 9(11): p. 2011-24 [PMID:9401124] Purugganan MD,Suddith JI Molecular population genetics of the Arabidopsis CAULIFLOWER regulatory gene: nonneutral evolution and naturally occurring variation in floral homeotic function. Proc. Natl. Acad. Sci. U.S.A., 1998. 95(14): p. 8130-4 [PMID:9653152] Sawa S,Ito T,Shimura Y,Okada K FILAMENTOUS FLOWER controls the formation and development of arabidopsis inflorescences and floral meristems. Plant Cell, 1999. 11(1): p. 69-86 [PMID:9878633]