PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT1G20700.1
Common NameATWOX14, F2D10.19, PALE2, WOX14
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family WOX
Protein Properties Length: 211aa    MW: 23975.9 Da    PI: 7.2154
Description WUSCHEL related homeobox 14
Gene Model
Gene Model ID Type Source Coding Sequence
AT1G20700.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox65.38.3e-2193153257
                  T--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
     Homeobox   2 rkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57 
                  r+R+t+t++ql++Le+ + + + +p++++++e+A++l    ++te++V++WFqNrRa+ k+
  AT1G20700.1  93 RHRWTPTSTQLQILESIYDEgSGTPNRRRIREIATELsehgQITETNVYNWFQNRRARSKR 153
                  89*****************99**************************************97 PP

2Wus_type_Homeobox102.14e-3392155265
  Wus_type_Homeobox   2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65 
                        +r+RWtPt++Q++iLe++y++G  tPn+++i++i++eL+e+G+i+++NV++WFQNr+aR+++kq
        AT1G20700.1  92 TRHRWTPTSTQLQILESIYDEGSGTPNRRRIREIATELSEHGQITETNVYNWFQNRRARSKRKQ 155
                        689***********************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.1E-1686158IPR009057Homeodomain-like
SuperFamilySSF466891.8E-1888158IPR009057Homeodomain-like
PROSITE profilePS5007114.75489154IPR001356Homeobox domain
SMARTSM003891.5E-1391158IPR001356Homeobox domain
PfamPF000461.9E-1893153IPR001356Homeobox domain
CDDcd000862.87E-1493155No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0001944Biological Processvasculature development
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010072Biological Processprimary shoot apical meristem specification
GO:0051301Biological Processcell division
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000037anatomyshoot apex
PO:0000084anatomyplant sperm cell
PO:0000230anatomyinflorescence meristem
PO:0006203anatomypericycle
PO:0009005anatomyroot
PO:0009010anatomyseed
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0020100anatomyhypocotyl
PO:0020148anatomyshoot apical meristem
PO:0025022anatomycollective leaf structure
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 211 aa     Download sequence    Send to blast
MVKKKKEKEK SKEIEEMDRE IQNGAYSGRV MTEEQMEILR KQIAVYAVIC DQLVLLHNSL  60
SSYHPLSSGV RPMVGGYFDP MGASSSSHRI STRHRWTPTS TQLQILESIY DEGSGTPNRR  120
RIREIATELS EHGQITETNV YNWFQNRRAR SKRKQPQTTT ANGQADDVAV TTEERRSCGD  180
SGGLESYEHI LFPSPDLGIE HLLSIGKFME T
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1146154RRARSKRKQ
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible256081_at0.0
Expression AtlasAT1G20700-
AtGenExpressAT1G20700-
ATTED-IIAT1G20700-
Functional Description ? help Back to Top
Source Description
TAIREncodes a WUSCHEL-related homeobox gene family member with 65 amino acids in its homeodomain. Proteins in this family contain a sequence of eight residues (TLPLFPMH) downstream of the homeodomain called the WUS box. Functions in the shoot meristem organizing center to maintain the stem cells in an undifferentiated state.
UniProtTranscription factor which may be involved in developmental processes. {ECO:0000250}.
Function -- GeneRIF ? help Back to Top
  1. WOX4 acts redundantly with WOX14 in the regulation of vascular cell division, but not in regulating vascular organisation
    [PMID: 23578929]
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT1G20700.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT1G20700
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAJ4412970.0AJ441297.1 Arabidopsis thaliana mRNA for homeodomain protein PALE-2 (pale-2 gene).
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_173493.21e-158WUSCHEL related homeobox 14
SwissprotQ9LM841e-159WOX14_ARATH; WUSCHEL-related homeobox 14
TrEMBLA0A1P8AUV11e-146A0A1P8AUV1_ARATH; WUSCHEL related homeobox 14
STRINGAT1G20700.11e-157(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM122111732
Representative plantOGRP18731639
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. R
    Rapid identification of Arabidopsis insertion mutants by non-radioactive detection of T-DNA tagged genes.
    Plant J., 2002. 32(2): p. 243-53
    [PMID:12383089]
  3. Haecker A, et al.
    Expression dynamics of WOX genes mark cell fate decisions during early embryonic patterning in Arabidopsis thaliana.
    Development, 2004. 131(3): p. 657-68
    [PMID:14711878]
  4. Tucker MR, et al.
    Vascular signalling mediated by ZWILLE potentiates WUSCHEL function during shoot meristem stem cell development in the Arabidopsis embryo.
    Development, 2008. 135(17): p. 2839-43
    [PMID:18653559]
  5. Deveaux Y, et al.
    Genes of the most conserved WOX clade in plants affect root and flower development in Arabidopsis.
    BMC Evol. Biol., 2008. 8: p. 291
    [PMID:18950478]
  6. Hirakawa Y,Kondo Y,Fukuda H
    TDIF peptide signaling regulates vascular stem cell proliferation via the WOX4 homeobox gene in Arabidopsis.
    Plant Cell, 2010. 22(8): p. 2618-29
    [PMID:20729381]
  7. Zhang X,Zong J,Liu J,Yin J,Zhang D
    Genome-wide analysis of WOX gene family in rice, sorghum, maize, Arabidopsis and poplar.
    J Integr Plant Biol, 2010. 52(11): p. 1016-26
    [PMID:20977659]
  8. Shin R,Jez JM,Basra A,Zhang B,Schachtman DP
    14-3-3 proteins fine-tune plant nutrient metabolism.
    FEBS Lett., 2011. 585(1): p. 143-7
    [PMID:21094157]
  9. Gaudinier A, et al.
    Enhanced Y1H assays for Arabidopsis.
    Nat. Methods, 2011. 8(12): p. 1053-5
    [PMID:22037706]
  10. Etchells JP,Provost CM,Mishra L,Turner SR
    WOX4 and WOX14 act downstream of the PXY receptor kinase to regulate plant vascular proliferation independently of any role in vascular organisation.
    Development, 2013. 140(10): p. 2224-34
    [PMID:23578929]
  11. Denis E, et al.
    WOX14 promotes bioactive gibberellin synthesis and vascular cell differentiation in Arabidopsis.
    Plant J., 2017. 90(3): p. 560-572
    [PMID:28218997]