PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | AT1G19000.2 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 285aa MW: 31230.8 Da PI: 5.7573 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 40.2 | 7.7e-13 | 103 | 147 | 3 | 47 |
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 +WT+ E+++++ + ++ G+g+Wk I+r + k Rt+ q+ s+ qky AT1G19000.2 103 PWTENEHKRFLIGLQKVGKGDWKGISRNFVKSRTPTQVASHAQKY 147 8*******************************************9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 15.116 | 96 | 152 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 1.12E-16 | 98 | 152 | IPR009057 | Homeodomain-like |
TIGRFAMs | TIGR01557 | 2.5E-17 | 99 | 150 | IPR006447 | Myb domain, plants |
SMART | SM00717 | 1.1E-6 | 100 | 150 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 6.9E-10 | 102 | 147 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 1.87E-6 | 103 | 148 | No hit | No description |
Pfam | PF00249 | 2.3E-9 | 103 | 147 | IPR001005 | SANT/Myb domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006338 | Biological Process | chromatin remodeling | ||||
GO:0006357 | Biological Process | regulation of transcription from RNA polymerase II promoter | ||||
GO:0035066 | Biological Process | positive regulation of histone acetylation | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003682 | Molecular Function | chromatin binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0003713 | Molecular Function | transcription coactivator activity | ||||
GO:0004402 | Molecular Function | histone acetyltransferase activity |
Plant Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PO Term | PO Category | PO Description | ||||
PO:0000005 | anatomy | cultured plant cell | ||||
PO:0000013 | anatomy | cauline leaf | ||||
PO:0000037 | anatomy | shoot apex | ||||
PO:0000230 | anatomy | inflorescence meristem | ||||
PO:0000293 | anatomy | guard cell | ||||
PO:0008019 | anatomy | leaf lamina base | ||||
PO:0009005 | anatomy | root | ||||
PO:0009006 | anatomy | shoot system | ||||
PO:0009009 | anatomy | plant embryo | ||||
PO:0009010 | anatomy | seed | ||||
PO:0009025 | anatomy | vascular leaf | ||||
PO:0009029 | anatomy | stamen | ||||
PO:0009030 | anatomy | carpel | ||||
PO:0009031 | anatomy | sepal | ||||
PO:0009032 | anatomy | petal | ||||
PO:0009046 | anatomy | flower | ||||
PO:0009047 | anatomy | stem | ||||
PO:0009052 | anatomy | flower pedicel | ||||
PO:0020030 | anatomy | cotyledon | ||||
PO:0020038 | anatomy | petiole | ||||
PO:0020100 | anatomy | hypocotyl | ||||
PO:0020137 | anatomy | leaf apex | ||||
PO:0025022 | anatomy | collective leaf structure | ||||
PO:0025281 | anatomy | pollen | ||||
PO:0001054 | developmental stage | vascular leaf senescent stage | ||||
PO:0001078 | developmental stage | plant embryo cotyledonary stage | ||||
PO:0001081 | developmental stage | mature plant embryo stage | ||||
PO:0001185 | developmental stage | plant embryo globular stage | ||||
PO:0004507 | developmental stage | plant embryo bilateral stage | ||||
PO:0007064 | developmental stage | LP.12 twelve leaves visible stage | ||||
PO:0007095 | developmental stage | LP.08 eight leaves visible stage | ||||
PO:0007098 | developmental stage | LP.02 two leaves visible stage | ||||
PO:0007103 | developmental stage | LP.10 ten leaves visible stage | ||||
PO:0007115 | developmental stage | LP.04 four leaves visible stage | ||||
PO:0007123 | developmental stage | LP.06 six leaves visible stage | ||||
PO:0007611 | developmental stage | petal differentiation and expansion stage | ||||
PO:0007616 | developmental stage | flowering stage |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 285 aa Download sequence Send to blast |
MAAVSSSSET GDCGVTGKRD EIMLFGVRVV VDPMRKCVSL NNLSDYEKSS PEDEIPKIVT 60 AGAGDGEDKN ETDATVIVAD GYASANDAVQ ISSSSGGRKR GVPWTENEHK RFLIGLQKVG 120 KGDWKGISRN FVKSRTPTQV ASHAQKYFLR RTNLNRRRRR SSLFDITTET VTEMAMEQDP 180 TQENSPLPET NISSGQQAMQ VFTDVPTKTE NAPETFHLND PYLVPVTFQA KPTFNLNTDA 240 APLSLNLCLA SSFNLNEQPN SRHSAFTMMP SFSDGDSNSS IIRVA |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
At.23413 | 0.0 | flower| inflorescence| leaf| root| seed| silique |
Expression -- Microarray ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | E-value | ||||
GEO | 15028048 | 0.0 | ||||
Genevisible | 259476_at | 0.0 | ||||
Expression Atlas | AT1G19000 | - | ||||
AtGenExpress | AT1G19000 | - | ||||
ATTED-II | AT1G19000 | - |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Binds selectively to the DNA sequence 5'-[GA]GATAA-3' and may act as a transcription factor involved in the regulation of drought-responsive genes. Enhances stomatal closure in response to abscisic acid (ABA). Confers drought and salt tolerance. {ECO:0000269|PubMed:21030505}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00149 | DAP | 27203113 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | AT1G19000.2 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Up-regulated by drought, high salinity, and ABA. {ECO:0000269|PubMed:21030505}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Phenotype -- Mutation ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | |||||
T-DNA Express | AT1G19000 |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AK316815 | 0.0 | AK316815.1 Arabidopsis thaliana AT1G19000 mRNA, complete cds, clone: RAFL08-11-F04. | |||
GenBank | AY045881 | 0.0 | AY045881.1 Arabidopsis thaliana putative Myb-related transcription activator protein (At1g19000) mRNA, complete cds. | |||
GenBank | AY079415 | 0.0 | AY079415.1 Arabidopsis thaliana putative Myb-related transcription activator protein (At1g19000) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_173334.1 | 0.0 | Homeodomain-like superfamily protein | ||||
Refseq | NP_849689.1 | 0.0 | Homeodomain-like superfamily protein | ||||
Swissprot | Q2V9B0 | 6e-55 | MY1R1_SOLTU; Transcription factor MYB1R1 | ||||
TrEMBL | A0A178W7J9 | 0.0 | A0A178W7J9_ARATH; Uncharacterized protein | ||||
TrEMBL | Q9LMC7 | 0.0 | Q9LMC7_ARATH; AT1G19000 protein | ||||
STRING | AT1G19000.2 | 0.0 | (Arabidopsis thaliana) |
Link Out ? help Back to Top | |
---|---|
Phytozome | AT1G19000.2 |
Entrez Gene | 838481 |
iHOP | AT1G19000 |
wikigenes | AT1G19000 |