PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

AT1G18570.1

Common Name

AtMYB51, BW51A, BW51B, F25I16.9, HIG1, MYB51

Organism

Arabidopsis thaliana

Taxonomic ID

3702

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis

Family

MYB

Protein Properties

Length: 352aa MW: 39154.4 Da PI: 5.6488

Description

myb domain protein 51

Gene Model

Gene Model ID	Type	Source	Coding Sequence
AT1G18570.1	genome	TAIR	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	53.9	4.1e-17	15	62	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+WT+eEd++l+ + +++G g W+t +++ g++R++k+c++rw +yl AT1G18570.1 15 KGAWTPEEDQKLLSYLNRHGEGGWRTLPEKAGLKRCGKSCRLRWANYL 62 79********************************************97 PP
2	Myb_DNA-binding	52.6	1e-16	68	112	1	47
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 rg +T++E+ ++ +++++G++ W++Iar ++ gRt++++k++w+++ AT1G18570.1 68 RGEFTEDEERSIISLHALHGNK-WSAIARGLP-GRTDNEIKNYWNTH 112 899*****************.*****.**********97 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51294	14.786	10	62	IPR017930	Myb domain
SuperFamily	SSF46689	5.99E-29	12	109	IPR009057	Homeodomain-like
SMART	SM00717	7.6E-13	14	64	IPR001005	SANT/Myb domain
Pfam	PF00249	1.3E-15	15	62	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	2.5E-23	16	69	IPR009057	Homeodomain-like
CDD	cd00167	8.62E-10	17	62	No hit	No description
PROSITE profile	PS51294	25.381	63	117	IPR017930	Myb domain
SMART	SM00717	3.4E-16	67	115	IPR001005	SANT/Myb domain
Pfam	PF00249	2.2E-15	68	112	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	6.2E-26	70	118	IPR009057	Homeodomain-like
CDD	cd00167	3.94E-12	70	113	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006357	Biological Process	regulation of transcription from RNA polymerase II promoter
GO:0009625	Biological Process	response to insect
GO:0009651	Biological Process	response to salt stress
GO:0009682	Biological Process	induced systemic resistance
GO:0009723	Biological Process	response to ethylene
GO:0009733	Biological Process	response to auxin
GO:0009737	Biological Process	response to abscisic acid
GO:0009739	Biological Process	response to gibberellin
GO:0009751	Biological Process	response to salicylic acid
GO:0009753	Biological Process	response to jasmonic acid
GO:0009759	Biological Process	indole glucosinolate biosynthetic process
GO:0030154	Biological Process	cell differentiation
GO:0052544	Biological Process	defense response by callose deposition in cell wall
GO:0005634	Cellular Component	nucleus
GO:0000981	Molecular Function	RNA polymerase II transcription factor activity, sequence-specific DNA binding
GO:0001135	Molecular Function	transcription factor activity, RNA polymerase II transcription factor recruiting
GO:0043565	Molecular Function	sequence-specific DNA binding
GO:0044212	Molecular Function	transcription regulatory region DNA binding

Plant Ontology ? help Back to Top
PO Term	PO Category	PO Description
PO:0000013	anatomy	cauline leaf
PO:0000037	anatomy	shoot apex
PO:0000230	anatomy	inflorescence meristem
PO:0000293	anatomy	guard cell
PO:0009005	anatomy	root
PO:0009015	anatomy	portion of vascular tissue
PO:0009025	anatomy	vascular leaf
PO:0009029	anatomy	stamen
PO:0009031	anatomy	sepal
PO:0009046	anatomy	flower
PO:0009047	anatomy	stem
PO:0009062	anatomy	gynoecium
PO:0020030	anatomy	cotyledon
PO:0020038	anatomy	petiole
PO:0020100	anatomy	hypocotyl
PO:0020137	anatomy	leaf apex
PO:0025022	anatomy	collective leaf structure
PO:0001054	developmental stage	vascular leaf senescent stage
PO:0007064	developmental stage	LP.12 twelve leaves visible stage
PO:0007095	developmental stage	LP.08 eight leaves visible stage
PO:0007098	developmental stage	LP.02 two leaves visible stage
PO:0007103	developmental stage	LP.10 ten leaves visible stage
PO:0007115	developmental stage	LP.04 four leaves visible stage
PO:0007123	developmental stage	LP.06 six leaves visible stage
PO:0007611	developmental stage	petal differentiation and expansion stage
PO:0007616	developmental stage	flowering stage

Sequence ? help Back to Top
Protein Sequence Length: 352 aa Download sequence Send to blast
MVRTPCCKAE LGLKKGAWTP EEDQKLLSYL NRHGEGGWRT LPEKAGLKRC GKSCRLRWAN 60 YLRPDIKRGE FTEDEERSII SLHALHGNKW SAIARGLPGR TDNEIKNYWN THIKKRLIKK 120 GIDPVTHKGI TSGTDKSENL PEKQNVNLTT SDHDLDNDKA KKNNKNFGLS SASFLNKVAN 180 RFGKRINQSV LSEIIGSGGP LASTSHTTNT TTTSVSVDSE SVKSTSSSFA PTSNLLCHGT 240 VATTPVSSNF DVDGNVNLTC SSSTFSDSSV NNPLMYCDNF VGNNNVDDED TIGFSTFLND 300 EDFMMLEESC VENTAFMKEL TRFLHEDEND VVDVTPVYER QDLFDEIDNY FG

Sequence ? help Back to Top

Protein Sequence Length: 352 aa Download sequence Send to blast

MVRTPCCKAE LGLKKGAWTP EEDQKLLSYL NRHGEGGWRT LPEKAGLKRC GKSCRLRWAN  60
YLRPDIKRGE FTEDEERSII SLHALHGNKW SAIARGLPGR TDNEIKNYWN THIKKRLIKK  120
GIDPVTHKGI TSGTDKSENL PEKQNVNLTT SDHDLDNDKA KKNNKNFGLS SASFLNKVAN  180
RFGKRINQSV LSEIIGSGGP LASTSHTTNT TTTSVSVDSE SVKSTSSSFA PTSNLLCHGT  240
VATTPVSSNF DVDGNVNLTC SSSTFSDSSV NNPLMYCDNF VGNNNVDDED TIGFSTFLND  300
EDFMMLEESC VENTAFMKEL TRFLHEDEND VVDVTPVYER QDLFDEIDNY FG

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1a5j_A	2e-28	13	117	5	108	B-MYB
Search in ModeBase

Expression -- UniGene ? help Back to Top
UniGene ID	E-value	Expressed in
At.10908	0.0	root\| seed\| vegetative tissue

Expression -- Microarray ? help Back to Top
Source	ID	E-value
GEO	42562150	0.0
Genevisible	255753_at	0.0
Expression Atlas	AT1G18570	-
AtGenExpress	AT1G18570	-
ATTED-II	AT1G18570	-

Expression -- Description ? help Back to Top
Source	Description
Uniprot	TISSUE SPECIFICITY: Expressed in vegetative parts of the plant, mainly in mature rosette leaves and in trichomes. Detected in roots, but not in mature flowers or siliques. {ECO:0000269\|PubMed:17461791, ECO:0000269\|PubMed:23115560}.

Functional Description ? help Back to Top
Source	Description
TAIR	Encodes a member of the R2R3-MYB transcription family. Involved in indole glucosinolate biosynthesis.
UniProt	Transcription factor positively regulating indolic glucosinolate biosynthetic pathway genes. {ECO:0000269\|PubMed:17461791, ECO:0000269\|PubMed:23580754, ECO:0000269\|PubMed:23943862}.

Function -- GeneRIF ? help Back to Top
MYB51 is a regulator of indolic glucosinolate biosynthesis that also controls responses to biotic challenges. [PMID: 17461791] interacts with basic helix-loop-helix transcription factor 05 [PMID: 25049362]

Binding Motif ? help Back to Top
Motif ID	Method	Source	Motif file
MP00147	DAP	27203113	Download

Cis-element ? help Back to Top
Source	Link
PlantRegMap	AT1G18570.1

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Up-regulated by touch or wounding. {ECO:0000269\|PubMed:17461791, ECO:0000269\|PubMed:23115560}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	Retrieve

Regulation -- ATRM (Manually Curated Upstream Regulators) ? help Back to Top
Source	Upstream Regulator (A: Activate/R: Repress)
ATRM	AT1G32640 (R)

Regulation -- ATRM (Manually Curated Target Genes) ? help Back to Top
Source	Target Gene (A: Activate/R: Repress)
ATRM	AT1G74100(A), AT2G22330(A), AT4G31500(A), AT4G39950(A), AT4G39980(A), AT5G54810(A)

Regulation -- Hormone ? help Back to Top
Source	Hormone
AHD	abscisic acid, auxin, ethylene, gibberellin, jasmonic acid, salicylic acid

Interaction ? help Back to Top
Source	Intact With
BioGRID	AT1G32640, AT1G52150

Phenotype -- Disruption Phenotype ? help Back to Top
Source	Description
UniProt	DISRUPTION PHENOTYPE: Low levels of indolic glucosinolates. {ECO:0000269\|PubMed:17461791, ECO:0000269\|PubMed:23580754}.

Phenotype -- Mutation ? help Back to Top
Source	ID
T-DNA Express	AT1G18570

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AK117331	0.0	AK117331.1 Arabidopsis thaliana At1g18570 mRNA for unknown protein, complete cds, clone: RAFL16-90-B03.
GenBank	AY519555	0.0	AY519555.1 Arabidopsis thaliana MYB transcription factor (At1g18570) mRNA, complete cds.
GenBank	BT006244	0.0	BT006244.1 Arabidopsis thaliana At1g18570 mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	NP_173292.1	0.0	myb domain protein 51
Swissprot	O49782	0.0	MYB51_ARATH; Transcription factor MYB51
TrEMBL	A0A178WB71	0.0	A0A178WB71_ARATH; MYB51
STRING	AT1G18570.1	0.0	(Arabidopsis thaliana)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM4	28	2646
Representative plant	OGRP5	17	1784

Link Out ? help Back to Top
Phytozome	AT1G18570.1
Entrez Gene	838438
iHOP	AT1G18570
wikigenes	AT1G18570

Publications ? help Back to Top
Riechmann JL, et al. Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes. Science, 2000. 290(5499): p. 2105-10 [PMID:11118137] Stracke R,Werber M,Weisshaar B The R2R3-MYB gene family in Arabidopsis thaliana. Curr. Opin. Plant Biol., 2001. 4(5): p. 447-56 [PMID:11597504] Seki M, et al. Functional annotation of a full-length Arabidopsis cDNA collection. Science, 2002. 296(5565): p. 141-5 [PMID:11910074] Yamada K, et al. Empirical analysis of transcriptional activity in the Arabidopsis genome. Science, 2003. 302(5646): p. 842-6 [PMID:14593172] Barth C,Moeder W,Klessig DF,Conklin PL The timing of senescence and response to pathogens is altered in the ascorbate-deficient Arabidopsis mutant vitamin c-1. Plant Physiol., 2004. 134(4): p. 1784-92 [PMID:15064386] S ABA activates ADPR cyclase and cADPR induces a subset of ABA-responsive genes in Arabidopsis. Plant J., 2004. 38(3): p. 381-95 [PMID:15086800] Ko JH,Han KH,Park S,Yang J Plant body weight-induced secondary growth in Arabidopsis and its transcription phenotype revealed by whole-transcriptome profiling. Plant Physiol., 2004. 135(2): p. 1069-83 [PMID:15194820] Guan Y,Nothnagel EA Binding of arabinogalactan proteins by Yariv phenylglycoside triggers wound-like responses in Arabidopsis cell cultures. Plant Physiol., 2004. 135(3): p. 1346-66 [PMID:15235117] Stanley Kim H, et al. Transcriptional divergence of the duplicated oxidative stress-responsive genes in the Arabidopsis genome. Plant J., 2005. 41(2): p. 212-20 [PMID:15634198] Schneider A, et al. A transposon-based activation-tagging population in Arabidopsis thaliana (TAMARA) and its application in the identification of dominant developmental and metabolic mutations. FEBS Lett., 2005. 579(21): p. 4622-8 [PMID:16087178] Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Yanhui C, et al. The MYB transcription factor superfamily of Arabidopsis: expression analysis and phylogenetic comparison with the rice MYB family. Plant Mol. Biol., 2006. 60(1): p. 107-24 [PMID:16463103] Thilmony R,Underwood W,He SY Genome-wide transcriptional analysis of the Arabidopsis thaliana interaction with the plant pathogen Pseudomonas syringae pv. tomato DC3000 and the human pathogen Escherichia coli O157:H7. Plant J., 2006. 46(1): p. 34-53 [PMID:16553894] AbuQamar S, et al. Expression profiling and mutant analysis reveals complex regulatory networks involved in Arabidopsis response to Botrytis infection. Plant J., 2006. 48(1): p. 28-44 [PMID:16925600] Xin Z,Mandaokar A,Chen J,Last RL,Browse J Arabidopsis ESK1 encodes a novel regulator of freezing tolerance. Plant J., 2007. 49(5): p. 786-99 [PMID:17316173] Lee J, et al. Analysis of transcription factor HY5 genomic binding sites revealed its hierarchical role in light regulation of development. Plant Cell, 2007. 19(3): p. 731-49 [PMID:17337630] Gigolashvili T, et al. The transcription factor HIG1/MYB51 regulates indolic glucosinolate biosynthesis in Arabidopsis thaliana. Plant J., 2007. 50(5): p. 886-901 [PMID:17461791] Dombrecht B, et al. MYC2 differentially modulates diverse jasmonate-dependent functions in Arabidopsis. Plant Cell, 2007. 19(7): p. 2225-45 [PMID:17616737] Ascencio-Ib Global analysis of Arabidopsis gene expression uncovers a complex array of changes impacting pathogen response and cell cycle during geminivirus infection. Plant Physiol., 2008. 148(1): p. 436-54 [PMID:18650403] Malitsky S, et al. The transcript and metabolite networks affected by the two clades of Arabidopsis glucosinolate biosynthesis regulators. Plant Physiol., 2008. 148(4): p. 2021-49 [PMID:18829985] Clay NK,Adio AM,Denoux C,Jander G,Ausubel FM Glucosinolate metabolites required for an Arabidopsis innate immune response. Science, 2009. 323(5910): p. 95-101 [PMID:19095898] Millet YA, et al. Innate immune responses activated in Arabidopsis roots by microbe-associated molecular patterns. Plant Cell, 2010. 22(3): p. 973-90 [PMID:20348432] O'Brien JA, et al. A peroxidase-dependent apoplastic oxidative burst in cultured Arabidopsis cells functions in MAMP-elicited defense. Plant Physiol., 2012. 158(4): p. 2013-27 [PMID:22319074] Maekawa S, et al. The Arabidopsis ubiquitin ligases ATL31 and ATL6 control the defense response as well as the carbon/nitrogen response. Plant Mol. Biol., 2012. 79(3): p. 217-27 [PMID:22481162] Meinke DW A survey of dominant mutations in Arabidopsis thaliana. Trends Plant Sci., 2013. 18(2): p. 84-91 [PMID:22995285] Laluk K, et al. The calmodulin-binding transcription factor SIGNAL RESPONSIVE1 is a novel regulator of glucosinolate metabolism and herbivory tolerance in Arabidopsis. Plant Cell Physiol., 2012. 53(12): p. 2008-15 [PMID:23072934] van de Mortel JE, et al. Metabolic and transcriptomic changes induced in Arabidopsis by the rhizobacterium Pseudomonas fluorescens SS101. Plant Physiol., 2012. 160(4): p. 2173-88 [PMID:23073694] Frerigmann H,B Glucosinolates are produced in trichomes of Arabidopsis thaliana. Front Plant Sci, 2012. 3: p. 242 [PMID:23115560] Mewis I,Khan MA,Glawischnig E,Schreiner M,Ulrichs C Water stress and aphid feeding differentially influence metabolite composition in Arabidopsis thaliana (L.). PLoS ONE, 2012. 7(11): p. e48661 [PMID:23144921] Dubois M, et al. Ethylene Response Factor6 acts as a central regulator of leaf growth under water-limiting conditions in Arabidopsis. Plant Physiol., 2013. 162(1): p. 319-32 [PMID:23553636] Guo R, et al. BZR1 and BES1 participate in regulation of glucosinolate biosynthesis by brassinosteroids in Arabidopsis. J. Exp. Bot., 2013. 64(8): p. 2401-12 [PMID:23580754] Schweizer F, et al. Arabidopsis basic helix-loop-helix transcription factors MYC2, MYC3, and MYC4 regulate glucosinolate biosynthesis, insect performance, and feeding behavior. Plant Cell, 2013. 25(8): p. 3117-32 [PMID:23943862] Benstein RM, et al. Arabidopsis phosphoglycerate dehydrogenase1 of the phosphoserine pathway is essential for development and required for ammonium assimilation and tryptophan biosynthesis. Plant Cell, 2013. 25(12): p. 5011-29 [PMID:24368794] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Frerigmann H,Gigolashvili T MYB34, MYB51, and MYB122 distinctly regulate indolic glucosinolate biosynthesis in Arabidopsis thaliana. Mol Plant, 2014. 7(5): p. 814-28 [PMID:24431192] Frerigmann H,Berger B,Gigolashvili T bHLH05 is an interaction partner of MYB51 and a novel regulator of glucosinolate biosynthesis in Arabidopsis. Plant Physiol., 2014. 166(1): p. 349-69 [PMID:25049362] Frerigmann H,Gigolashvili T Update on the role of R2R3-MYBs in the regulation of glucosinolates upon sulfur deficiency. Front Plant Sci, 2014. 5: p. 626 [PMID:25426131] Jin J, et al. An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors. Mol. Biol. Evol., 2015. 32(7): p. 1767-73 [PMID:25750178] Peskan-Berghöfer T, et al. Sustained exposure to abscisic acid enhances the colonization potential of the mutualist fungus Piriformospora indica on Arabidopsis thaliana roots. New Phytol., 2015. 208(3): p. 873-86 [PMID:26075497] Frerigmann H,Glawischnig E,Gigolashvili T The role of MYB34, MYB51 and MYB122 in the regulation of camalexin biosynthesis in Arabidopsis thaliana. Front Plant Sci, 2015. 6: p. 654 [PMID:26379682] Frerigmann H, et al. Regulation of Pathogen-Triggered Tryptophan Metabolism in Arabidopsis thaliana by MYB Transcription Factors and Indole Glucosinolate Conversion Products. Mol Plant, 2016. 9(5): p. 682-695 [PMID:26802248] Bulgakov VP,Veremeichik GN,Grigorchuk VP,Rybin VG,Shkryl YN The rolB gene activates secondary metabolism in Arabidopsis calli via selective activation of genes encoding MYB and bHLH transcription factors. Plant Physiol. Biochem., 2016. 102: p. 70-9 [PMID:26913794] Xu J, et al. Pathogen-Responsive MPK3 and MPK6 Reprogram the Biosynthesis of Indole Glucosinolates and Their Derivatives in Arabidopsis Immunity. Plant Cell, 2016. 28(5): p. 1144-62 [PMID:27081184] Miao H, et al. Glucose enhances indolic glucosinolate biosynthesis without reducing primary sulfur assimilation. Sci Rep, 2016. 6: p. 31854 [PMID:27549907] Romero I, et al. More than 80R2R3-MYB regulatory genes in the genome of Arabidopsis thaliana. Plant J., 1998. 14(3): p. 273-84 [PMID:9628022] Kranz HD, et al. Towards functional characterisation of the members of the R2R3-MYB gene family from Arabidopsis thaliana. Plant J., 1998. 16(2): p. 263-76 [PMID:9839469]