PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | AT1G17310.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
|
||||||||
Family | M-type_MADS | ||||||||
Protein Properties | Length: 217aa MW: 24919.7 Da PI: 9.616 | ||||||||
Description | M-type_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 66 | 3.9e-21 | 55 | 103 | 1 | 49 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49 k+ie++++rqvtfskRr g++KK ELSvL++a++avi fs+ +++y + AT1G17310.1 55 KKIEEETKRQVTFSKRRRGLFKKSAELSVLTGAKIAVITFSKCDRIYRF 103 68****************************************9999988 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50066 | 24.67 | 47 | 107 | IPR002100 | Transcription factor, MADS-box |
SMART | SM00432 | 3.0E-25 | 47 | 106 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 9.94E-23 | 48 | 122 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 5.0E-19 | 49 | 69 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 7.3E-21 | 56 | 103 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00266 | 5.06E-19 | 61 | 131 | No hit | No description |
PRINTS | PR00404 | 5.0E-19 | 69 | 84 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 5.0E-19 | 84 | 105 | IPR002100 | Transcription factor, MADS-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Plant Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PO Term | PO Category | PO Description | ||||
PO:0000052 | anatomy | petiole vascular system | ||||
PO:0000056 | anatomy | flower bud | ||||
PO:0000084 | anatomy | plant sperm cell | ||||
PO:0000115 | anatomy | socket cell | ||||
PO:0000146 | anatomy | abscission zone | ||||
PO:0005021 | anatomy | sepal margin | ||||
PO:0009030 | anatomy | carpel | ||||
PO:0009032 | anatomy | petal | ||||
PO:0009052 | anatomy | flower pedicel | ||||
PO:0009081 | anatomy | inflorescence branch | ||||
PO:0020030 | anatomy | cotyledon | ||||
PO:0020093 | anatomy | antipodal cell | ||||
PO:0020127 | anatomy | primary root | ||||
PO:0025074 | anatomy | embryo sac | ||||
PO:0007616 | developmental stage | flowering stage |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 217 aa Download sequence Send to blast |
MKDLFMEGER ETSSMTCLTP KDSVQSPNML VRQPKKETTT QTPKTTRGRQ KIEIKKIEEE 60 TKRQVTFSKR RRGLFKKSAE LSVLTGAKIA VITFSKCDRI YRFGHVDALI DKYLRKSPVK 120 LEGYSGDNAA DEESRRPWWE RPVESVPEEE LEEYMAALSM LRENIGKKIV AMGNDRTVDM 180 VPAWPINVMG WKPTMDMQKL ENLTDGVNRC RVGQNGD |
Expression -- Microarray ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | E-value | ||||
Genevisible | 260845_at | 0.0 | ||||
Expression Atlas | AT1G17310 | - | ||||
AtGenExpress | AT1G17310 | - | ||||
ATTED-II | AT1G17310 | - |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | AT1G17310.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Phenotype -- Mutation ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | |||||
T-DNA Express | AT1G17310 |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AY141240 | 0.0 | AY141240.1 Arabidopsis thaliana MADS-box protein AGL100 mRNA, complete cds. | |||
GenBank | BT025284 | 0.0 | BT025284.1 Arabidopsis thaliana At1g17310 mRNA, complete cds. | |||
GenBank | CP002684 | 0.0 | CP002684.1 Arabidopsis thaliana chromosome 1 sequence. | |||
GenBank | DQ446258 | 0.0 | DQ446258.1 Arabidopsis thaliana clone pENTR221-At1g17310 MADS-box protein (At1g17310) mRNA, complete cds. | |||
GenBank | T13M22 | 0.0 | AC026479.2 Sequence of BAC T13M22 from Arabidopsis thaliana chromosome 1, complete sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_001322190.1 | 1e-161 | MADS-box transcription factor family protein | ||||
Refseq | NP_173175.1 | 1e-161 | MADS-box transcription factor family protein | ||||
TrEMBL | A0A1P8AT79 | 1e-159 | A0A1P8AT79_ARATH; MADS-box transcription factor family protein | ||||
TrEMBL | Q9LN16 | 1e-159 | Q9LN16_ARATH; At1g17310 | ||||
STRING | AT1G17310.1 | 1e-160 | (Arabidopsis thaliana) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM4697 | 20 | 52 | Representative plant | OGRP16 | 17 | 761 |
Link Out ? help Back to Top | |
---|---|
Phytozome | AT1G17310.1 |
Entrez Gene | 838303 |
iHOP | AT1G17310 |
wikigenes | AT1G17310 |