PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | AT1G14685.1 | ||||||||
Common Name | ATBPC2, BBR/BPC2, BPC2, F10B6_22, F10B6.5, T5E21.17 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
|
||||||||
Family | BBR-BPC | ||||||||
Protein Properties | Length: 279aa MW: 31168.5 Da PI: 10.2698 | ||||||||
Description | basic pentacysteine 2 | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | GAGA_bind | 362.2 | 1e-110 | 1 | 279 | 1 | 301 |
GAGA_bind 1 mdddgsrernkgyyepa.aslkenlglqlmssiaerdaki....rernlalsekkaavaerd....maflqrdkalaernkalverdnkllalllven 89 mdddg+ rn+gyyepa a++k nlglqlms+i +r++k+ r+ nl ++++++++++++ m++ +++++ +++k++++l+v++ AT1G14685.1 1 MDDDGF--RNWGYYEPAaATFKGNLGLQLMSTI-DRNTKPflpgRDPNL-MMGPNGSYHHQEppihMSY----NWINQ-------QKDKFFNMLPVTT 83 99**99..9*******999**************.9**************.************5555555....*****.......899*******998 PP GAGA_bind 90 slasalpvgvqvlsgtksidslqq..lsepqledsavelreeeklealpieeaaeeakekkkkkkrqrakkpkekkakkkkkksekskkkvkkesade 185 + +p++ +vl++t+s+ s+q+ +++ q+e+++v+l+e +i+ + ++kk+k + + +++pk+kk +k+k+++++++++++++ + AT1G14685.1 84 A----TPNYGNVLPETSSAPSMQMnlHHHLQTEENPVKLEE-------EIV----V-QTKKRKTNAKAGSTPKAKKPRKPKDENSNNNNNNNTNV--T 163 6....9******************64444777777776222.......221....1.22222333567899***********8888877777777..7 PP GAGA_bind 186 rskaekksidlvlngvslDestlPvPvCsCtGalrqCYkWGnGGWqSaCCtttiSvyPLPvstkrrgaRiagrKmSqgafkklLekLaaeGydlsnpv 283 r+k kks+dlv+ngvs+D+s+lPvP+C+CtGa++qCY+WG+GGWqSaCCtt+iS++PLP+stkrrgaRi+grKmSqgafkk+LekLa++G++++np+ AT1G14685.1 164 RVKPAKKSVDLVINGVSMDISGLPVPICTCTGAPQQCYRWGCGGWQSACCTTNISMHPLPMSTKRRGARISGRKMSQGAFKKVLEKLASDGFNFGNPI 261 9************************************************************************************************* PP GAGA_bind 284 DLkdhWAkHGtnkfvtir 301 DLk+hWA+HGtnkfvtir AT1G14685.1 262 DLKSHWARHGTNKFVTIR 279 *****************8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF06217 | 2.1E-99 | 1 | 279 | IPR010409 | GAGA-binding transcriptional activator |
SMART | SM01226 | 6.1E-181 | 1 | 279 | IPR010409 | GAGA-binding transcriptional activator |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0009723 | Biological Process | response to ethylene | ||||
GO:0050793 | Biological Process | regulation of developmental process | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding |
Plant Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PO Term | PO Category | PO Description | ||||
PO:0000013 | anatomy | cauline leaf | ||||
PO:0000037 | anatomy | shoot apex | ||||
PO:0000084 | anatomy | plant sperm cell | ||||
PO:0000230 | anatomy | inflorescence meristem | ||||
PO:0000256 | anatomy | root hair cell | ||||
PO:0000262 | anatomy | trichoblast | ||||
PO:0000293 | anatomy | guard cell | ||||
PO:0008019 | anatomy | leaf lamina base | ||||
PO:0009005 | anatomy | root | ||||
PO:0009006 | anatomy | shoot system | ||||
PO:0009009 | anatomy | plant embryo | ||||
PO:0009010 | anatomy | seed | ||||
PO:0009025 | anatomy | vascular leaf | ||||
PO:0009029 | anatomy | stamen | ||||
PO:0009030 | anatomy | carpel | ||||
PO:0009031 | anatomy | sepal | ||||
PO:0009032 | anatomy | petal | ||||
PO:0009046 | anatomy | flower | ||||
PO:0009047 | anatomy | stem | ||||
PO:0009052 | anatomy | flower pedicel | ||||
PO:0020030 | anatomy | cotyledon | ||||
PO:0020038 | anatomy | petiole | ||||
PO:0020100 | anatomy | hypocotyl | ||||
PO:0020137 | anatomy | leaf apex | ||||
PO:0025022 | anatomy | collective leaf structure | ||||
PO:0025195 | anatomy | pollen tube cell | ||||
PO:0025281 | anatomy | pollen | ||||
PO:0001016 | developmental stage | L mature pollen stage | ||||
PO:0001017 | developmental stage | M germinated pollen stage | ||||
PO:0001054 | developmental stage | vascular leaf senescent stage | ||||
PO:0001078 | developmental stage | plant embryo cotyledonary stage | ||||
PO:0001081 | developmental stage | mature plant embryo stage | ||||
PO:0001185 | developmental stage | plant embryo globular stage | ||||
PO:0004507 | developmental stage | plant embryo bilateral stage | ||||
PO:0007064 | developmental stage | LP.12 twelve leaves visible stage | ||||
PO:0007095 | developmental stage | LP.08 eight leaves visible stage | ||||
PO:0007098 | developmental stage | LP.02 two leaves visible stage | ||||
PO:0007103 | developmental stage | LP.10 ten leaves visible stage | ||||
PO:0007115 | developmental stage | LP.04 four leaves visible stage | ||||
PO:0007123 | developmental stage | LP.06 six leaves visible stage | ||||
PO:0007611 | developmental stage | petal differentiation and expansion stage | ||||
PO:0007616 | developmental stage | flowering stage |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 279 aa Download sequence Send to blast |
MDDDGFRNWG YYEPAAATFK GNLGLQLMST IDRNTKPFLP GRDPNLMMGP NGSYHHQEPP 60 IHMSYNWINQ QKDKFFNMLP VTTATPNYGN VLPETSSAPS MQMNLHHHLQ TEENPVKLEE 120 EIVVQTKKRK TNAKAGSTPK AKKPRKPKDE NSNNNNNNNT NVTRVKPAKK SVDLVINGVS 180 MDISGLPVPI CTCTGAPQQC YRWGCGGWQS ACCTTNISMH PLPMSTKRRG ARISGRKMSQ 240 GAFKKVLEKL ASDGFNFGNP IDLKSHWARH GTNKFVTIR |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
At.15024 | 0.0 | bud| flower| inflorescence| root| seed| silique |
Expression -- Microarray ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | E-value | ||||
Genevisible | 262848_at | 0.0 | ||||
Expression Atlas | AT1G14685 | - | ||||
AtGenExpress | AT1G14685 | - | ||||
ATTED-II | AT1G14685 | - |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in seedlings, leaves and pistils. Detected in the base of flowers and tips of carpels, in sepal and petal vasculature, in pollen grains, in young rosette, in the lateral and tip of primary roots, and in ovule at the exception of the outer integument. {ECO:0000269|PubMed:14731261, ECO:0000269|PubMed:21435046}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
TAIR | Arabidopsis GBP Basic Penta Cysteine 1 | |||||
UniProt | Transcriptional regulator that specifically binds to GA-rich elements (GAGA-repeats) present in regulatory sequences of genes involved in developmental processes. {ECO:0000269|PubMed:14731261}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | AT1G14685.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Phenotype -- Mutation ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | |||||
T-DNA Express | AT1G14685 |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AC006917 | 0.0 | AC006917.6 Genomic sequence for Arabidopsis thaliana BAC F10B6 from chromosome I, complete sequence. | |||
GenBank | AC010657 | 0.0 | AC010657.3 Genomic sequence for Arabidopsis thaliana BAC T5E21 from chromosome I, complete sequence. | |||
GenBank | AY058073 | 0.0 | AY058073.1 Arabidopsis thaliana At1g14680/F10B6_22 mRNA, complete cds. | |||
GenBank | AY090305 | 0.0 | AY090305.1 Arabidopsis thaliana At1g14680/F10B6_22 mRNA, complete cds. | |||
GenBank | AY380568 | 0.0 | AY380568.1 Arabidopsis thaliana basic pentacysteine 2 (BPC2) mRNA, complete cds. | |||
GenBank | CP002684 | 0.0 | CP002684.1 Arabidopsis thaliana chromosome 1 sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_001321304.1 | 0.0 | basic pentacysteine 2 | ||||
Refseq | NP_563955.1 | 0.0 | basic pentacysteine 2 | ||||
Refseq | NP_849662.1 | 0.0 | basic pentacysteine 2 | ||||
Refseq | NP_973828.1 | 0.0 | basic pentacysteine 2 | ||||
Swissprot | Q9LDE2 | 0.0 | BPC2_ARATH; Protein BASIC PENTACYSTEINE2 | ||||
TrEMBL | A0A178W364 | 0.0 | A0A178W364_ARATH; BPC2 | ||||
STRING | AT1G14685.3 | 0.0 | (Arabidopsis thaliana) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM2893 | 27 | 69 | Representative plant | OGRP1865 | 12 | 40 |
Link Out ? help Back to Top | |
---|---|
Phytozome | AT1G14685.1 |
Entrez Gene | 838031 |
iHOP | AT1G14685 |
wikigenes | AT1G14685 |