PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | AT1G13450.3 | ||||||||
Common Name | GT-1, T6J4.18 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
|
||||||||
Family | Trihelix | ||||||||
Protein Properties | Length: 278aa MW: 31810.4 Da PI: 9.2724 | ||||||||
Description | Trihelix family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | trihelix | 87 | 2.1e-27 | 87 | 168 | 2 | 86 |
trihelix 2 WtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqle 86 W ++e++ Li +rr m+ ++++k++k+lWe++s+kmre+gf rsp++C++kw+nl k++kk k++++++ s +++y++++e AT1G13450.3 87 WVQDETRSLIMFRRGMDGLFNTSKSNKHLWEQISSKMREKGFDRSPTMCTDKWRNLLKEFKKAKHHDRGN---GSAKMSYYKEIE 168 ********************************************************************94...566899***998 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.60 | 1.5E-4 | 77 | 148 | IPR009057 | Homeodomain-like |
PROSITE profile | PS50090 | 8.026 | 79 | 143 | IPR017877 | Myb-like domain |
SMART | SM00717 | 0.0062 | 83 | 145 | IPR001005 | SANT/Myb domain |
CDD | cd12203 | 8.61E-29 | 85 | 150 | No hit | No description |
Pfam | PF13837 | 7.8E-21 | 86 | 169 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0042802 | Molecular Function | identical protein binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Plant Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PO Term | PO Category | PO Description | ||||
PO:0000013 | anatomy | cauline leaf | ||||
PO:0000037 | anatomy | shoot apex | ||||
PO:0000084 | anatomy | plant sperm cell | ||||
PO:0000230 | anatomy | inflorescence meristem | ||||
PO:0000293 | anatomy | guard cell | ||||
PO:0008019 | anatomy | leaf lamina base | ||||
PO:0009005 | anatomy | root | ||||
PO:0009006 | anatomy | shoot system | ||||
PO:0009009 | anatomy | plant embryo | ||||
PO:0009010 | anatomy | seed | ||||
PO:0009025 | anatomy | vascular leaf | ||||
PO:0009029 | anatomy | stamen | ||||
PO:0009030 | anatomy | carpel | ||||
PO:0009031 | anatomy | sepal | ||||
PO:0009032 | anatomy | petal | ||||
PO:0009046 | anatomy | flower | ||||
PO:0009047 | anatomy | stem | ||||
PO:0009052 | anatomy | flower pedicel | ||||
PO:0020030 | anatomy | cotyledon | ||||
PO:0020038 | anatomy | petiole | ||||
PO:0020100 | anatomy | hypocotyl | ||||
PO:0020137 | anatomy | leaf apex | ||||
PO:0025022 | anatomy | collective leaf structure | ||||
PO:0025195 | anatomy | pollen tube cell | ||||
PO:0025281 | anatomy | pollen | ||||
PO:0001017 | developmental stage | M germinated pollen stage | ||||
PO:0001054 | developmental stage | vascular leaf senescent stage | ||||
PO:0001078 | developmental stage | plant embryo cotyledonary stage | ||||
PO:0001081 | developmental stage | mature plant embryo stage | ||||
PO:0001185 | developmental stage | plant embryo globular stage | ||||
PO:0004507 | developmental stage | plant embryo bilateral stage | ||||
PO:0007064 | developmental stage | LP.12 twelve leaves visible stage | ||||
PO:0007095 | developmental stage | LP.08 eight leaves visible stage | ||||
PO:0007098 | developmental stage | LP.02 two leaves visible stage | ||||
PO:0007103 | developmental stage | LP.10 ten leaves visible stage | ||||
PO:0007115 | developmental stage | LP.04 four leaves visible stage | ||||
PO:0007123 | developmental stage | LP.06 six leaves visible stage | ||||
PO:0007611 | developmental stage | petal differentiation and expansion stage | ||||
PO:0007616 | developmental stage | flowering stage |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 278 aa Download sequence Send to blast |
MFISDKSRPT DFYKDDHHNS STTSTTRDMM IDVLTTTNES VDLQSHHHHN HHNHHLHQSQ 60 PQQQILLGES SGEDHEVKAP KKRAETWVQD ETRSLIMFRR GMDGLFNTSK SNKHLWEQIS 120 SKMREKGFDR SPTMCTDKWR NLLKEFKKAK HHDRGNGSAK MSYYKEIEDI LRERSKKVTP 180 PQYNKSPNTP PTSAKVDSFM QFTDKGFDDT SISFGSVEAN GRPALNLERR LDHDGHPLAI 240 TTAVDAVAAN GVTPWNWRET PGNGKSSEKA YINLSLKV |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
2jmw_A | 1e-58 | 81 | 166 | 1 | 86 | DNA binding protein GT-1 |
Search in ModeBase |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
At.430 | 0.0 | flower| root| silique |
Expression -- Microarray ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | E-value | ||||
Genevisible | 259412_at | 2e-68 | ||||
Expression Atlas | AT1G13450 | - | ||||
AtGenExpress | AT1G13450 | - | ||||
ATTED-II | AT1G13450 | - |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor that binds specifically to the core DNA sequence 5'-GGTTAA-3'. May act as a molecular switch in response to light signals. {ECO:0000269|PubMed:10437822, ECO:0000269|PubMed:15044016, ECO:0000269|PubMed:7866025}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00141 | DAP | 27203113 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | AT1G13450.3 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Interaction ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Intact With | |||||
IntAct | Search Q9FX53 |
Phenotype -- Mutation ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | |||||
T-DNA Express | AT1G13450 |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AK228305 | 0.0 | AK228305.1 Arabidopsis thaliana mRNA for hypothetical protein, complete cds, clone: RAFL14-74-C23. | |||
GenBank | ATHGT | 0.0 | L36806.1 Arabidopsis thaliana (clone pDGT1) GT-1 mRNA. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_001117279.1 | 0.0 | Homeodomain-like superfamily protein | ||||
Refseq | NP_001318993.1 | 0.0 | Homeodomain-like superfamily protein | ||||
Swissprot | Q9FX53 | 0.0 | TGT1_ARATH; Trihelix transcription factor GT-1 | ||||
TrEMBL | A0A178WM96 | 0.0 | A0A178WM96_ARATH; GT-1 | ||||
STRING | AT1G13450.1 | 0.0 | (Arabidopsis thaliana) |
Link Out ? help Back to Top | |
---|---|
Phytozome | AT1G13450.3 |
Entrez Gene | 837905 |
iHOP | AT1G13450 |
wikigenes | AT1G13450 |