PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | AT1G07640.3 | ||||||||
Common Name | OBP2, URP3 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
|
||||||||
Family | Dof | ||||||||
Protein Properties | Length: 339aa MW: 36507.3 Da PI: 9.775 | ||||||||
Description | Dof family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | zf-Dof | 121.4 | 3.2e-38 | 85 | 140 | 6 | 61 |
zf-Dof 6 lkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 lkcprCds+ntkfCyynny+l+qPr+fCk+CrryWt+GGalrnvPvGgg+r+n+k+ AT1G07640.3 85 LKCPRCDSSNTKFCYYNNYNLTQPRHFCKGCRRYWTQGGALRNVPVGGGCRRNNKK 140 79**************************************************9986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
ProDom | PD007478 | 1.0E-36 | 67 | 136 | IPR003851 | Zinc finger, Dof-type |
PROSITE profile | PS50884 | 29.627 | 85 | 139 | IPR003851 | Zinc finger, Dof-type |
Pfam | PF02701 | 3.5E-32 | 85 | 139 | IPR003851 | Zinc finger, Dof-type |
PROSITE pattern | PS01361 | 0 | 87 | 123 | IPR003851 | Zinc finger, Dof-type |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003002 | Biological Process | regionalization | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0009611 | Biological Process | response to wounding | ||||
GO:0009625 | Biological Process | response to insect | ||||
GO:0009753 | Biological Process | response to jasmonic acid | ||||
GO:0010439 | Biological Process | regulation of glucosinolate biosynthetic process | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0044212 | Molecular Function | transcription regulatory region DNA binding | ||||
GO:0046872 | Molecular Function | metal ion binding |
Plant Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PO Term | PO Category | PO Description | ||||
PO:0000013 | anatomy | cauline leaf | ||||
PO:0000037 | anatomy | shoot apex | ||||
PO:0000230 | anatomy | inflorescence meristem | ||||
PO:0000293 | anatomy | guard cell | ||||
PO:0003015 | anatomy | primary root differentiation zone | ||||
PO:0005417 | anatomy | phloem | ||||
PO:0006203 | anatomy | pericycle | ||||
PO:0008019 | anatomy | leaf lamina base | ||||
PO:0009005 | anatomy | root | ||||
PO:0009006 | anatomy | shoot system | ||||
PO:0009009 | anatomy | plant embryo | ||||
PO:0009010 | anatomy | seed | ||||
PO:0009025 | anatomy | vascular leaf | ||||
PO:0009029 | anatomy | stamen | ||||
PO:0009030 | anatomy | carpel | ||||
PO:0009031 | anatomy | sepal | ||||
PO:0009032 | anatomy | petal | ||||
PO:0009046 | anatomy | flower | ||||
PO:0009047 | anatomy | stem | ||||
PO:0009052 | anatomy | flower pedicel | ||||
PO:0020030 | anatomy | cotyledon | ||||
PO:0020038 | anatomy | petiole | ||||
PO:0020100 | anatomy | hypocotyl | ||||
PO:0020137 | anatomy | leaf apex | ||||
PO:0025022 | anatomy | collective leaf structure | ||||
PO:0025257 | anatomy | primary root elongation zone | ||||
PO:0025281 | anatomy | pollen | ||||
PO:0001054 | developmental stage | vascular leaf senescent stage | ||||
PO:0001078 | developmental stage | plant embryo cotyledonary stage | ||||
PO:0001081 | developmental stage | mature plant embryo stage | ||||
PO:0001185 | developmental stage | plant embryo globular stage | ||||
PO:0004507 | developmental stage | plant embryo bilateral stage | ||||
PO:0007064 | developmental stage | LP.12 twelve leaves visible stage | ||||
PO:0007095 | developmental stage | LP.08 eight leaves visible stage | ||||
PO:0007098 | developmental stage | LP.02 two leaves visible stage | ||||
PO:0007103 | developmental stage | LP.10 ten leaves visible stage | ||||
PO:0007115 | developmental stage | LP.04 four leaves visible stage | ||||
PO:0007123 | developmental stage | LP.06 six leaves visible stage | ||||
PO:0007611 | developmental stage | petal differentiation and expansion stage | ||||
PO:0007616 | developmental stage | flowering stage |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 339 aa Download sequence Send to blast |
MAFPSNWSQP TNSNHQHHLQ HQLNENGSII SGHGLVLSHQ LPPLQANPNP NHHHVATSAG 60 LPSRMGGSMA ERARQANIPP LAGPLKCPRC DSSNTKFCYY NNYNLTQPRH FCKGCRRYWT 120 QGGALRNVPV GGGCRRNNKK GKNGNLKSSS SSSKQSSSVN AQSPSSGQLR TNHQFPFSPT 180 LYNLTQLGGI GLNLAATNGN NQAHQIGSSL MMSDLGFLHG RNTSTPMTGN IHENNNNNNN 240 ENNLMASVGS LSPFALFDPT TGLYAFQNDG NIGNNVGISG SSTSMVDSRV YQTPPVKMEE 300 QPNLANLSRP VSGLTSPGNQ TNQYFWPGSD FSGPSNDLL |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
At.14846 | 0.0 | flower| root |
Expression -- Microarray ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | E-value | ||||
Genevisible | 261409_at | 0.0 | ||||
Expression Atlas | AT1G07640 | - | ||||
AtGenExpress | AT1G07640 | - | ||||
ATTED-II | AT1G07640 | - |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: In roots, confined to the central cylinder (vascular tissue and pericycle) of both main and lateral roots. In leaves, expressed in the vasculature, mostly in phloem cells. Also present in the vasculature of stems and in stamen filaments of flowers. Detected at low levels in the vasculature of petals and carpels. {ECO:0000269|PubMed:16740150}. | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in the vasculature (mainly in the phloem and associated cell files) of cotyledons, leaves, roots, flower stalks and petals (PubMed:10758484, PubMed:16740150, PubMed:23057675). The PEAR proteins (e.g. DOF2.4, DOF5.1, DOF3.2, DOF1.1, DOF5.6 and DOF5.3) form a short-range concentration gradient that peaks at protophloem sieve elements (PSE) (PubMed:30626969). {ECO:0000269|PubMed:10758484, ECO:0000269|PubMed:16740150, ECO:0000269|PubMed:23057675, ECO:0000269|PubMed:30626969}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
TAIR | A member of the DOF transcription factors. Prominently expressed in the phloem of leaves and other organs. Expression is induced by wounding, MeJA and insect feeding. Upregulates glucosinolate biosynthesis. | |||||
UniProt | Transcription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence. Enhances the DNA binding of OBF transcription factors to OCS elements (By similarity). Involved in the regulation of root development (PubMed:23057675). The PEAR proteins (e.g. DOF2.4, DOF5.1, DOF3.2, DOF1.1, DOF5.6 and DOF5.3) activate gene expression that promotes radial growth of protophloem sieve elements (PubMed:30626969). Element of a regulatory network controlling indole glucosinolates (IGS) biosynthesis, probably by inducing the expression of accurate genes (e.g. CYP83B1). Promotes apical dominance (PubMed:16740150). {ECO:0000250|UniProtKB:Q9M2U1, ECO:0000269|PubMed:16740150, ECO:0000269|PubMed:23057675, ECO:0000269|PubMed:30626969}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | AT1G07640.3 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By auxin and salicylic acid (SA) (PubMed:10758484). Induced transiently in response to the generalist herbivore S.littoralis. Triggered by methyl jasmonate (MeJA) and wounding (PubMed:16740150). {ECO:0000269|PubMed:10758484, ECO:0000269|PubMed:16740150}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Regulation -- ATRM (Manually Curated Target Genes) ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Target Gene (A: Activate/R: Repress) | |||||
ATRM | AT2G22330(A), AT3G56970(A), AT3G56980(A), AT4G31500(A), AT4G39950(A), AT5G23010(A) |
Regulation -- Hormone ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hormone | |||||
AHD | jasmonic acid |
Phenotype -- Mutation ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | ID | |||||
T-DNA Express | AT1G07640 |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AY062715 | 0.0 | AY062715.1 Arabidopsis thaliana Strong similarity to zinc finger protein OBP2 (At1g07640; F24B9.30) mRNA, complete cds. | |||
GenBank | CP002684 | 0.0 | CP002684.1 Arabidopsis thaliana chromosome 1 sequence. | |||
GenBank | F24B9 | 0.0 | AC007583.2 Arabidopsis thaliana chromosome 1 BAC F24B9 sequence, complete sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_001030988.1 | 0.0 | Dof-type zinc finger DNA-binding family protein | ||||
Swissprot | Q8L9V6 | 0.0 | DOF11_ARATH; Dof zinc finger protein DOF1.1 | ||||
TrEMBL | Q2V4Q1 | 0.0 | Q2V4Q1_ARATH; Dof-type zinc finger DNA-binding family protein | ||||
STRING | AT1G07640.3 | 0.0 | (Arabidopsis thaliana) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM5336 | 17 | 49 | Representative plant | OGRP38 | 17 | 445 |
Link Out ? help Back to Top | |
---|---|
Phytozome | AT1G07640.3 |
Entrez Gene | 837277 |
iHOP | AT1G07640 |
wikigenes | AT1G07640 |